β-Amyloid (1-40), HFIP-treated TFA
Based on 3 publication(s) in Google Scholar
β-Amyloid (1-40), HFIP-treated is a β-Amyloid (1-40) (HY-P0265A) treated with HFIP. β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
For research use only. We do not sell to patients.
- Purity: 99.47%
- Formula: C194H295N53O58S.xC2HF3O2
- Molecular Weight:4329.80 (free base)
-
Storage:
Sealed storage, away from moisture.
Pure form -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) β-Amyloid (1-40), HFIP-treated TFA
More
Biological Activity
Description
In Vivo
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.
β-Amyloid (1-40) can be used in animal modeling to create Alzheimer's disease models.
Administration: 0, 3, 30, 300 pmol • connection of cannulae to modified micro-osmotic pumps for infusion • 2 weeks
(2) In each group of 7 rats, a catheter was placed into the left ventricle on day 1. A water maze task was performed on days 9-13 after the start of infusion. At the end of the behavioural experiments, 4 rats from each group were taken from each group and processed by severing their heads for ChAT activity assay. Three rats were taken for histochemical studies.
(3) In histochemical studies, rats were anaesthetised and executed by transaortic perfusion fixation, first in cold saline and then in 4% paraformaldehyde and 0.1 M sodium phosphate buffer. Brains were removed and fixed in the same fixative for 12 hours. Frozen brain tissue was cut at 20 μm using a cryostat and the periventricular region was collected.
Organizational changes: Accumulation of β-Amyloid in the hippocampus and cerebral cortex.
Phenotypic observation: Memory impairment occurs.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Oil
-
Molecular Weight 4329.80 (free base)
-
Formula C194H295N53O58S.xC2HF3O2
-
Color Colorless to light yellow
-
Sequence
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
-
Sequence Shortening
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Pure form -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
2023 Dec;10(36):e2303402. PMID: 37949676 -
Neurol Int
Cognitive and Histological Methodological Framework for an Intrahippocampal Aβ1-42 Rat Model of Alzheimer's Disease. [Abstract]2026 Apr 24;18(5):79. PMID: 42188679 -
Korean J Physiol Pharmacol
Analysis of the mechanism of fibrauretine alleviating Alzheimer's disease based on transcriptomics and proteomics. [Abstract]2024 Jul 1;28(4):361-377. PMID: 38926843
Solvent & Solubility
In Vitro:
0.1 M NaOH : ≥ 25 mg/mL
DMSO : ≥ 25 mg/mL
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (293 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)