142948-19-4
Chemical Structure
Scyllatoxin
Synonym(s): Leiurotoxin I
- CAS No.: 142948-19-4
- Formula:C142H237N45O39S7
- Molecular Weight:3423.15
InChIKey: VNWKTOKETHGBQD-UHFFFAOYSA-N
SMILES: [AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28)]
Biological Activity: Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo[1].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Scyllatoxin | Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||