Scyllatoxin
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo.
For research use only. We do not sell to patients.
- CAS No.: 142948-19-4
- Formula: C142H237N45O39S7
- Molecular Weight:3423.15
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
For scyllatoxin, the Arg6 and Arg13 are essential for binding to the Ca2+-activated K+ channel protein and for the functional effect of the toxin[1]. For scyllatoxin, His31 is important for the binding activity of the toxin and for the induction of contractions on taenia coli[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 142948-19-4
-
Molecular Weight 3423.15
-
Formula C142H237N45O39S7
-
Synonyms
Leiurotoxin I
-
Sequence Shortening
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Auguste P, et al. Scyllatoxin, a blocker of Ca(2+)-activated K+ channels: structure-function relationships and brain localization of the binding sites. Biochemistry. 1992 Jan 28;31(3):648-54. [Content Brief]
[2]. Akiyama T, et al. Role of Ca2+-activated K+ channels in catecholamine release from in vivo rat adrenal medulla. Neurochem Int. 2010 Jan;56(2):263-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Scyllatoxin Related Classifications
HY-P3064 Related Classifications
Powered by Bioz