1802086-19-6
Chemical Structure
(D-Asp1)-Amyloid β-Protein (1-42)
- CAS No.: 1802086-19-6
- Formula:C203H311N55O60S
- Molecular Weight:4514.04
SMILES: [{d-Asp}-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA]
Biological Activity: (D-Asp1)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease[1].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
(D-Asp1)-Amyloid β-Protein (1-42) | (D-Asp1)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||