89750-15-2
Chemical Structure
Glucagon-Like Peptide (GLP) II, human
- CAS No.: 89750-15-2
- Formula:C165H254N44O55S
- Molecular Weight:3766.20
SMILES: [HADGSFSDEMNTILDNLAARDFINWLIQTKITD]
Biological Activity: Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes [1].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Glucagon-Like Peptide (GLP) II, human | Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes . | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||