Phlotoxin-1
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C183H254N46O48S6
- Masse moléculaire:4058.64
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
NaV1.7[1]
Chemical Information
-
Masse moléculaire 4058.64
-
Formule C183H254N46O48S6
-
Synonyms
PhlTx1
-
Sequence
Ala-Cys-Leu-Gly-Gln-Trp-Asp-Ser-Cys-Asp-Pro-Lys-Ala-Ser-Lys-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Glu-Trp-Lys-Tyr-Pro-Trp-Cys-Arg-Tyr-Lys-Leu-Phe (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Gonçalves TC, et al. Evaluation of the Spider (Phlogiellus genus) Phlotoxin 1 and Synthetic Variants as Antinociceptive Drug Candidates. Toxins (Basel). 2019 Aug 22;11(9):484. [Content Brief]
[2]. Nicolas S, et al. Chemical Synthesis, Proper Folding, Nav Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Phlotoxin-1 Related Classifications
HY-P5160 Related Classifications
Powered by Bioz