CY5-β-Amyloid (1-42), (rat/mouse)
CY5-β-Amyloid (1-42), (rat/mouse) (CY5-Ahx-Amyloid β-peptide (1-42) (rat/mouse)) is a far-red fluorescent dye Cy5-labeled β-Amyloid (1-42), (rat/mouse) (HY-P1388) (Ex/Em ≈ 651 nm/670 nm). CY5-β-Amyloid (1-42), (rat/mouse) can be used in the basic research of Alzheimer's disease (AD) and related neurodegenerative diseases to monitor the aggregation, distribution and interaction of Aβ peptide segments in real time.
For research use only. We do not sell to patients.
- Formula: C232H345N55O66S3
- Molecular Weight:5056.75
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
-
Help & FAQs
Biological Activity
Description
Chemical Information
-
Molecular Weight 5056.75
-
Formula C232H345N55O66S3
-
Synonyms
CY5-Ahx-Amyloid β-peptide (1-42) (rat/mouse)
-
Sequence
{CY5}-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
-
Sequence Shortening
{CY5}-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
CY5-β-Amyloid (1-42), (rat/mouse) Related Classifications
HY-P1388F1 Related Classifications
Powered by Bioz