1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LDHA Protein, Human (His)

LDHA protein catalyzes the stereospecific interconversion of pyruvate and lactate, concomitantly exchanging NADH and NAD(+). LDHA Protein, Human (His) is the recombinant human-derived LDHA protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

LDHA protein catalyzes the stereospecific interconversion of pyruvate and lactate, concomitantly exchanging NADH and NAD(+). LDHA Protein, Human (His) is the recombinant human-derived LDHA protein, expressed by E. coli , with N-6*His labeled tag.

Background

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+).

Biological Activity

Measured by its ability to reduce pyruvate to lactate. The specific activity is > 70000 pmol/min/μg, as measured under the described conditions.

Assay Procedure

Materials
Assay buffer: 25 mM Tris, 100 mM NaCl, pH 7.5
LDHA Protein, Human (His) (HY-P70225)
beta-NADH (diluted to 20 mM with 0.1 M sodium borate), pH 9.0
sodium pyruvate (HY-W015913)

Procedure
1. Dilute Human LDHA to 0.4 ng/uL using assay buffer.
2. Substrate mixture: A substrate mixture containing 1.6 mM beta-NADH and 4 mM sodium pyruvate was prepared using assay buffer.
3. Experimental group: 50 μL protein + 50 μL substrate mixture.
Blank group: 50 μL assay buffer + 50 μL substrate mixture.
4. Plates were read in kinetic mode at 340 nm (absorbance) for 5 minutes.
5. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (OD/min) x well volume (L) x 1012 pmol/mol
ext. coeff ** (M-1cm-1) x path corr.*** (cm) x amount of enzyme (μg)


*Adjusted for Control
**ext. coeff:6220 M-1cm-1
***path correction: 0.320 cm

Per Well:
Human LDHA: 0.02 μg
beta-NADH: 0.8 mM
sodium pyruvate: 2 mM

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P00338-1 (M1-F332)

Gene ID
Molecular Construction
N-term
6*His
LDHA (M1-F332)
Accession # P00338-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHuL-lactate dehydrogenase A chain/LDH-A, His; L-Lactate Dehydrogenase A Chain; LDH-A; Cell Proliferation-Inducing Gene 19 Protein; LDH Muscle Subunit; LDH-M; Renal Carcinoma Antigen NY-REN-59; LDHA
AA Sequence

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

분자량

Approximately 34.0-38.0 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 5% trehalose, 5% mannitol, 0.01% Tween 80, 1 mM EDTA, 50% glycerol, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0, 20% glycerol.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
References

LDHA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

LDHA Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
LDHA Protein, Human (His)
Cat. No.:
HY-P70225
수량:
MCE Japan Authorized Agent: