LDHB Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag.

Background

LDHB protein, also known as Lactate Dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. LDHB protein efficiently catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. This enzymatic activity is accompanied by the reciprocal interconversion of NADH and NAD(+), which are essential coenzymes involved in redox reactions. LDHB helps facilitate the conversion of pyruvate, a product of glycolysis, into lactate, and vice versa. This interconversion process is important for maintaining the balance of lactate and pyruvate in cells and is critical for energy production and the regulation of cellular redox state.

Verified Bioactivity

Measured by its ability to reduce pyruvate to lactate. The specific activity is 101589.5 pmol/min/μg, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • LDHB (M1-L334)
      Accession # P07195
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    LDHB; LDH-H; Lactate Dehydrogenase B; Epididymis Secretory Protein Li 281; L-Lactate Dehydrogenase B Chain; Testicular Secretory Protein Li 25; Renal Carcinoma Antigen NY-REN-46; Lactate Dehydrogenase H Chain; LDH Heart Subunit; L-Lactate Dehydrogenase; H

  • AA Sequence

    MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

  • Predicted Molecular Mass

    38.8 kDa

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00