Copy Link Print Information

LD78-beta/CCL3L1 Protein, Human

Customer Review

Based on 1 Customer Validation

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LD78-beta/CCL3L1 Protein, Human
  • Experimental Validation Results for LD78-beta/CCL3L1 Protein, Human
  • LD78-beta/CCL3L1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

Background

CCL3L1 is the most potent known ligand for CC chemokine receptor 5 (CCR5), the major coreceptor for HIV, and it is a dominant HIV-suppressive chemokine. Possession of a CCL3L1 copy number lower than the population average is associated with markedly enhanced HIV/acquired immunodeficiency syndrome (AIDS) susceptibility[1].

Verified Bioactivity

1.The ED50 is <0.4 μg/mL as measured by CHO cells, corresponding to a specific activity of >2.5 × 103 units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is <0.4 ng/mL corresponding to a specific activity is 2.5×106 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P16619 (A24-A93)

  • Gene ID
    6349  [NCBI]
  • Molecular Construction
    • N-term
    • CCL3L1 (A24-A93)
      Accession # P16619
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL3L1; Small Inducible Cytokine A3-Like 1; Prev. D17S1718; LD78-Beta(1-70); Prev. SCYA3L1; LD78BETA; Prev. SCYA3L; Small-Inducible Cytokine A3-Like 1; G0S19-2; PAT 464.2; Tonsillar Lymphocyte LD78 Beta Protein; MIP1AP; Chemokine (C-C Motif) Ligand 3-Like

  • AA Sequence

    APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

  • Predicted Molecular Mass

    7.8 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Urban TJ, et al. CCL3L1 and HIV/AIDS susceptibility. Nat Med. 2009 Oct;15(10):1110-2. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 0.3247 ng/mL corresponding to a specific activity is 3.080×106 U/mg.

  • LD78-beta/CCL3L1 Protein, Human Product Image
    1/16
  • Experimental Validation Results for LD78-beta/CCL3L1 Protein, Human
  • Experimental Validation Results for LD78-beta/CCL3L1 Protein, Human
  • LD78-beta/CCL3L1 Protein, Human Product Image