Adiponectin/Acrp30 Protein, Mouse (227a.a)
Based on 1 publication(s) in Google Scholar
Adiponectin/Acrp30 Protein, Mouse (227a.a) suppresses endothelial inflammatory response and vascular smooth muscle cell proliferation, as well as macrophage-to-foam cell transformation.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Adiponectin/Acrp30 Protein, Mouse (227a.a) suppresses endothelial inflammatory response and vascular smooth muscle cell proliferation, as well as macrophage-to-foam cell transformation.
Background
Recombinant Mouse Adiponectin promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity, and is negatively correlated with obesity, type 2 diabetes, and atherogenesis. Adiponectin is also an anti-inflammatory agent; it exerts pro-inflammatory effects in nonmetabolic disorders such as rheumatoid arthritis and inflammatory bowel disease.
Verified Bioactivity
1.The ED50 is <5 μg/mL as measured by M1 cells, corresponding to a specific activity of >2.0 × 102 units/mg.
2. Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 1.841 μg/mL, Corresponding to a specific activity is 543.183 U/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Respir Res
Isthmin-1 attenuates allergic Asthma by stimulating adiponectin expression and alveolar macrophage efferocytosis in mice. [Abstract]2023 Nov 6;24(1):269. PMID: 37932719
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q60994 (V21-N247)
-
Molecular Construction
-
N-term
-
Acrp30 (V21-N247)
Accession # Q60994 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ADIPOQ; Adipocyte, C1Q And Collagen Domain Containing; Prev. ACDC; Adipose Specific Collagen-Like Factor; Adiponectin; Gelatin-Binding Protein 28; ACRP30; Gelatin-Binding Protein; GBP28; Adiponectin Precursor; ApM1; ADIPQTL1; Adipose Most Abundant Gene Tr
-
AA Sequence
VTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
