6Ckine/CCL21B Protein, Mouse

Customer Review

Based on 1 Customer Validation

6Ckine/CCL21B Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Mouse  is a recombinant mouse 6Ckine/CCL21B (S24-G133) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

6Ckine/CCL21B Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Mouse  is a recombinant mouse 6Ckine/CCL21B (S24-G133) expressed by E. coli[1].

Background

CCL21, also known as exodus-2 and secondary lymphoid chemokine (SLC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 9 in the human genome. It binds to glycosaminoglycan (GAG) and is anchored to the surface of endothelial cells. As a chemokine, CCL21 inhibits hematopoiesis and stimulates chemotaxis, and is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages or neutrophils. At the same time, CCL21 is a potent stimulator of T cell migration and adhesion, binding to the glycoprotein PSGL-1 on T cells to promote the migration of T cells to secondary lymphoid organs. CCL21 can act through chemokine receptors CCR7 and CXCR3. Among them, CCR7 is a GPCR that is normally expressed by T cell subsets central memory cells, thymic T cells, B cells, mature DCs and other rare cell subsets. ccl21 can function as a microglia activator in the CNS and is expressed exclusively in endangered or mechanically damaged neurons[1][2].

In Vitro

CCL21 (intrathecal administration, 0.06 μg/mouse, once, 14 days) results in a significant and instantaneous decrease in paw withdrawal threshold (PWT) to 0.93 g, which returns to the control value of 1.44 g within 48 hours in wild-type C57BL/6 mice, also causes a rapid decrease in PWT to 0.721 g and does not show any recovery throughout the experiment in paucity of lymphoid T cells (plt) mutation mice[2].
CCL21 (antibodies neutralization 10 μg/injection, twice weekly) reduces Pancreatic ductal adenocarcinoma (PDAC)-induced abdominal hypersensitivity, alleviates pain associated with pancreatic ductal adenocarcinoma and improves health status in situ mouse model of PDAC in C57BL/6 mice injected with K8484 cells[3].

In Vivo

CCL21(0-3 nM, 24 h) induces a rapid and significant upregulation of P2X4 protein expression of  microglia at concentrations as low as 1 nM[2].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using murine T-lymphocytes is in a concentration range of 10-100 ng/mL.
2.Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7.The ED50 for this effect is 13.57 ng/mL, corresponding to a specific activity is 7.37×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 13.57 ng/mL, corresponding to a specific activity is 7.37×104 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CC21B (S24-G133)
      Accession # P86792
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Scya21b; Scya21; Ccl21b; TCA4; Thymus-derived chemotactic agent 4; Small-inducible cytokine A21b; Beta-chemokine exodus-2; 6Ckine; C-C motif chemokine 21b

  • AA Sequence

    SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

  • Predicted Molecular Mass

    12.1 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4-8.0, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00