Copy Link Print Information

IL-11 Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

IL-11 Protein, Mouse (HEK293) is a HEK293 cell derived pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-11 Protein, Mouse (HEK293)
  • Experimental Validation Results for IL-11 Protein, Mouse (HEK293)
  • IL-11 Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-11 Protein, Mouse (HEK293) is a HEK293 cell derived pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types.

Background

Interleukin-11 (IL-11) is a pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types, all roles critical to placental development. IL-11 is a member of the IL-6-type cytokines and signals via the IL11 receptor (R) α chain and signal transducer gp130 to activate the Janus kinase (JAK)/Signal transducers and activators of transcription (STAT)3 pathway in human endometrium and primary human extravillous trophoblast (EVT) . IL-11 is required for decidualization in humans and mice. IL11 levels are elevated in preeclampsia (PE) decidual tissue. L-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell[1].

Verified Bioactivity

1.The ED50 is <3 ng/mL as measured by a cell proliferation assay using T11 cells.
2.Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 2-8 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 5.224 ng/mL, corresponding to a specific activity is 1.914×10^5 U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P47873 (G23-L199)

  • Gene ID
    16156  [NCBI]
  • Molecular Construction
    • N-term
    • IL-11 (G23-L199)
      Accession # P47873
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL11; Adipogenesis Inhibitory Factor; Interleukin 11; Interleukin-11; IL-11; Oprelvekin; AGIF

  • AA Sequence

    GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Winship AL, et al. Interleukin-11 alters placentation and causes preeclampsia features in mice. Proc Natl Acad Sci U S A. 2015 Dec 29;112(52):15928-33. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 5.224 ng/mL, corresponding to a specific activity is 1.914×10^5 U/mg.

  • IL-11 Protein, Mouse (HEK293) Product Image
    1/16
  • Experimental Validation Results for IL-11 Protein, Mouse (HEK293)
  • Experimental Validation Results for IL-11 Protein, Mouse (HEK293)
  • IL-11 Protein, Mouse (HEK293) Product Image