IL-11 Protein, Mouse

Customer Review

Based on 1 Customer Validation

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

Background

The IL-11 Protein emerges as a versatile cytokine with multifaceted roles, stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells while inducing megakaryocyte maturation, leading to heightened platelet production. Additionally, IL-11 contributes to hepatocyte proliferation in response to liver damage. Upon binding to its receptor, formed by IL6ST and either IL11RA1 or IL11RA2, IL-11 activates a signaling cascade promoting cell proliferation, a process implicated in various cancers. This signaling triggers the activation of intracellular protein kinases and the phosphorylation of STAT3. Notably, the interaction with membrane-bound IL11RA and IL6ST leads to 'classic signaling,' while the binding of soluble IL11RA to IL6ST stimulates 'trans-signaling.' IL-11 further forms a multimeric signaling complex by interacting with either IL11RA1 or IL11RA2, highlighting its pivotal role in orchestrating diverse cellular responses.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 2.386-5.863 ng/mL, corresponding to a specific activity is 3.05×105-4.19×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 2.386 ng/mL, corresponding to a specific activity is 4.19×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-11 (P22-L199)
      Accession # P47873
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL11; Adipogenesis Inhibitory Factor; Interleukin 11; Interleukin-11; IL-11; Oprelvekin; AGIF

  • AA Sequence

    PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00