Copy Link Print Information

PDGF-BB Protein, Mouse

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

PDGF-BB Protein, Mouse is an active PDGF isoform, used in cell culture applications.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • PDGF-BB Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-BB Protein, Mouse is an active PDGF isoform, used in cell culture applications.

Background

Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization[1].

Verified Bioactivity

The ED50 is <2.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >4 × 105 units/mg.

Results
  • Experimental Validation Results for PDGF-BB Protein, Mouse
    Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The ED50 for this effect is 1.035 ng/mL, corresponding to a specific activity is 9.66×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P31240 (S82-T190)

  • Gene ID
    18591  [NCBI]
  • Molecular Construction
    • N-term
    • PDGF-BB (S82-T190)
      Accession # P31240
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    rMuPDGF-BB; PDGF-2; GDGF; ODGF; SIS; SSV

  • AA Sequence

    SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

  • Molecular Weight

    Approximately 13 kDa under reduced (R) conditions, 25 kDa under non reducing (N) conditions, based on SDS-PAGE.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for PDGF-BB Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM sodium citrate, pH 3.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, pH 4.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23(1):32-39. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The ED50 for this effect is 1.035 ng/mL, corresponding to a specific activity is 9.66×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The ED50 for this effect is 1.035 ng/mL, corresponding to a specific activity is 9.66×105 units/mg.

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]

    Customer Validation
     PDGFBB (200 ng/mL, 12 h) increased Periostin expression in Pdgfr+/+ and Pdgfra−/− cells, but not in Pdgfrb−/− fibroblasts.

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]

    Customer Validation
     PDGFBB (200 ng/mL, 12 h) upregulated Periostin, p-PI3K, and p-AKT in the PDGFRb knockout CD34+ cells.

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]

    Customer Validation
     Exogenous and reciprocal endogenous co-immunoprecipitation experiments demonstrated the interaction between PDGFRb and PI3K in CD34+ cells treated with PDGFBB (200 ng/mL, 12 h).

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Biol Toxicol. 2025 Oct 16;41(1):140. [Abstract]

    Customer Validation
     PDGF-BB (20 ng/ml, 12 h) reversed PJ34-induced cell growth inhibition in vascular smooth muscle cells.

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Biol Toxicol. 2025 Oct 16;41(1):140. [Abstract]

    Customer Validation
     PDGF-BB (20 ng/ml, 12 h) reversed PJ34-induced cell migration inhibition in vascular smooth muscle cells.

  • 1/16

    PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2023 Jan 19;14(1):40. [Abstract]

    Customer Validation
     PDGF-BB (20 ng/mL, 72 h), TGF-β1 (5 ng/mL, 72 h), and VEGFA (5 ng/mL, 72 h) upregulated the protein expression of collagen I, α-SMA, and NRP1 in primary HSCs.

  • PDGF-BB Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • Experimental Validation Results for PDGF-BB Protein, Mouse
  • PDGF-BB Protein, Mouse Product Image