1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6 Family CDNF/MANF family
  5. CNTF Protein, Mouse

CNTF Protein, Mouse

Cat. No.: HY-P7147
Handling Instructions

CNTF Protein, Mouse, a pluripotent neurotrophic factor, could protect retinal cone and rod photoreceptors.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P51642 (A2-M198)

Gene ID

12803

Synonyms
rMuCNTF; Ciliary Neurotrophic Factor
AA Sequence

AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM

Molecular Weight

Approximately 22.6 kDa

Biological Activity
The ED50 is <30 ng/mL as measured by its ability to induce alkaline phosphatase production by TF-1 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Ciliary Neurotrophic Factor (CNTF) is an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells[1]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNTF Protein, Mouse
Cat. No.:
HY-P7147
Quantity:
MCE Japan Authorized Agent: