1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Glial Cell Line-derived Neurotrophic Factor (GDNF)
  6. GDNF Protein, Human

GDNF Protein, Human

Cat. No.: HY-P7182
COA Handling Instructions

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $75 In-stock
10 μg $210 In-stock
50 μg $620 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211).

Background

Glial cell line-derived neurotrophic factor (GDNF) is a 134 amino acid protein belonging in the GDNF family ligands (GFLs). GDNF protein is widely distributed throughout both the central and peripheral nervous systems. Synthesis and secretion of GDNF occur in many cell types such as glial cells like astrocytes, oligodendrocytes, and Schwann cells; motor neurons (MNs); and skeletal muscle[1].
Mature human GDNF shares 91-92% amino acid sequence identity with mouse, rat, and Canine GDNF proteins. While, mouse GDNF shares 99% aa sequence identity with rat GDNF protein.
GDNF is originally isolated from cultured B49 rat glial cells and found to enhance the survival and differentiation of dopaminergic neurons in primary cultures by promoting dopamine uptake. Similar to other members of the TGF-β superfamily, GDNF is first synthesized as a precursor protein (pro-GDNF). After a series of protein cleavage and processing, the 211 amino acid pro-GDNF is finally converted into the active and mature form of GDNF. GDNF has the ability to trigger receptor tyrosine kinase RET phosphorylation, whose downstream effects have been found to promote neuronal health and survival. The binding of GDNF to its receptors triggers several intracellular signaling pathways which play roles in promoting the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. The synthesis and regulation of GDNF have been shown to be altered in many diseases, aging, exercise, and addiction. The neuroprotective effects of GDNF may be used to develop treatments and therapies to ameliorate neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS)[1].
GDNF is a potent neurotrophic factor for regulating MN survival in the peripheral nervous system. GDNF prevents apoptosis of MNs during development in vivo, decreases the loss of MNs in animal models of motor neuropathy and degeneration, rescues MNs from axotomy-induced cell death, and protects MNs from chronic degeneration. Intracerebral GDNF administration exerts both protective and reparative effects on the nigrostriatal dopamine system, which may have implications for the development of new treatment strategies for Parkinson's disease[1][2].

In Vitro

Recombinant human GDNF (100 ng/mL; 24 hours) increases transepithelial electric resistance (TER) significantly to 2.99 of baseline (2.23-fold of controls) in Caco2 cells. GDNF contributes to IEB maturation[3].

Biological Activity

1.The ED50 is <5 μg/mL as measured by C6 cells.
2.Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 1.972 ng/mL, corresponding to a specific activity is 5.07×105 units/mg in the presence of Recombinant Human GFR alpha -1/GDNF R alpha -1 .

  • Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 1.972 ng/mL, corresponding to a specific activity is 5.07×105 units/mg in the presence of Recombinant Human GFR alpha -1/GDNF R alpha -1 .
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P39905 (S78-I211)

Gene ID
Synonyms
rHuGDNF; ATF
AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Weight

Approximately 17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20mM PB, 150mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCL, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDNF Protein, Human
Cat. No.:
HY-P7182
Quantity:
MCE Japan Authorized Agent: