Copy Link Print Information

BDNF Protein, Human/Mouse/Rat

15 Cited Publications
Customer Review

Based on 15 publication(s) in Google Scholar

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

For research use only. We do not sell to patients.
  • Species: Mouse; Rat; Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • BDNF Protein, Human/Mouse/Rat Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

Background

BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].

In Vitro

BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].

In Vivo

BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].

Verified Bioactivity

1.Immobilized Human TrkB-His at 5 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is ≤6 ng/mL.
2.Immobilized Human TrkB-His at 2 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is <100 ng/mL.
3.Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.
4.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is <2 ng/mL.

Results
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
    Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.

Technical Parameters

  • Species Mouse; Rat; Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P23560-1 (H129-R247)/P21237-1 (H131-R249)/P23363 (H131-R249)

  • Gene ID
    627  [NCBI]/12064/24225
  • Molecular Construction
    • N-term
    • BDNF (H129-R247)
      Accession # P23560
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    BDNF/Brain-derived neurotrophic factor; Abrineurin

  • AA Sequence

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

  • Predicted Molecular Mass

    13.5 kDa

  • Molecular Weight

    Approximately 14-19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 400 mM NaCl，pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11(6):1164-78. [Content Brief]

[2]. Li M, et al. Recombinant human brain-derived neurotrophic factor prevents neuronal apoptosis in a novel in vitro model of subarachnoid hemorrhage. Neuropsychiatr Dis Treat. 2017 Apr 3;13:1013-1021. [Content Brief]

[3]. Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56(5):3295-3312. [Content Brief]

[4]. Hang P, et al. Brain-derived neurotrophic factor attenuates doxorubicin-induced cardiac dysfunction through activating Akt signalling in rats. J Cell Mol Med. 2017 Apr;21(4):685-696. [Content Brief]

[5]. Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112(2):257-69. [Content Brief]

[6]. Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22(5-6):663-74. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.

  • 1/16

    BDNF Protein, Human/Mouse/Rat purchased from MedChemExpress. Usage Cited in: Front Public Health. 2021 Nov 22;9:771508. [Abstract]

    Customer Validation
     Example images of primary hippocampal neruons were taken with a 20✕ optical microscope and recognized by ImageJ software. BDNF Protein (40 ng/ml) was incubated with primary hippocampal neurons for 48 hours as a positive control. MEK1/2 inhibitor PD98059 (50μM) was treated neurons for 48 hours as a negative control. BDNF treatment of primary hippocampal neurons could increase the average neurites length by 50% compared with sham, and could promote the number of primary neurites. However, PD98059 treatment of inhibited average neurites length by about 60%, and decreased the number of primary, secondary neurites and branch points per neuron.

  • BDNF Protein, Human/Mouse/Rat Product Image
    1/16
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • Experimental Validation Results for BDNF Protein, Human/Mouse/Rat
  • BDNF Protein, Human/Mouse/Rat Product Image

  • BDNF Protein, Human/Mouse/Rat purchased from MedChemExpress. Usage Cited in: Front Public Health. 2021 Nov 22;9:771508. [Abstract]

    Example images of primary hippocampal neruons were taken with a 20✕ optical microscope and recognized by ImageJ software. BDNF Protein (40 ng/ml) was incubated with primary hippocampal neurons for 48 hours as a positive control. MEK1/2 inhibitor PD98059 (50μM) was treated neurons for 48 hours as a negative control. BDNF treatment of primary hippocampal neurons could increase the average neurites length by 50% compared with sham, and could promote the number of primary neurites. However, PD98059 treatment of inhibited average neurites length by about 60%, and decreased the number of primary, secondary neurites and branch points per neuron.