BDNF Protein, Human/Mouse/Rat
Based on 15 publication(s) in Google Scholar
Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.
- Species: Mouse; Rat; Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.
Background
BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].
In Vitro
BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].
In Vivo
BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].
Verified Bioactivity
1.Immobilized Human TrkB-His at 5 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is ≤6 ng/mL.
2.Immobilized Human TrkB-His at 2 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is <100 ng/mL.
3.Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.
4.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is <2 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (15)
-
Journal Impact Factor
-
Most Recent
-
Cell Stem Cell
Human PSC-derived sinoatrial node-cardiac plexus assembloids model innervation-associated maturation of pacemaker systems. [Abstract]2026 May 15:S1934-5909(26)00158-X. PMID: 42143017 -
Autophagy
PRKN activation for mitophagy requires an NME3-regulated phosphatidic acid signal that separates mitochondria from endoplasmic reticulum tethering. [Abstract]2026 May;22(5):963-981. PMID: 41640016 -
Nat Commun
PCGF6 controls neuroectoderm specification of human pluripotent stem cells by activating SOX2 expression. [Abstract]2022 Aug 6;13(1):4601. PMID: 35933409 -
J Adv Res
Role of Netrin-1 dysregulation in early neuronal pathology of α-synuclein models of Parkinson's disease. [Abstract]2026 Jun:84:587-601. PMID: 40889702 -
Adv Sci (Weinh)
Hepatocyte BDNF Acts as a Novel Immune Checkpoint to Restrain TLR4-Mediated Acute Hepatitis. [Abstract]2026 Mar 25:e21164. PMID: 41881032 -
Cancer Lett
Rab8A promotes breast cancer progression by increasing surface expression of Tropomyosin-related kinase B. [Abstract]2022 Jun 1:535:215629. PMID: 35278612 -
EMBO Mol Med
Isoginkgetin antagonizes ALS pathologies in its animal and patient iPSC models via PINK1-Parkin-dependent mitophagy. [Abstract]2025 Oct 15. PMID: 41094045 -
Stem Cell Res Ther
Mesenchymal stem cells derived from hPSC via neural crest attenuate chemotherapy-induced premature ovarian insufficiency by ameliorating apoptosis and oxidative stress in granulosa cells. [Abstract]2025 May 13;16(1):239. PMID: 40361250 -
Cell Rep
Nerve-proximal tertiary lymphoid structures predict chemotherapy sensitivity in pancreatic cancer. [Abstract]2026 Jun 4;45(6):117496. PMID: 42241282 -
Front Cell Dev Biol
2021 Sep 8:9:702462. PMID: 34568320 -
Front Public Health
1,800 MHz Radiofrequency Electromagnetic Irradiation Impairs Neurite Outgrowth With a Decrease in Rap1-GTP in Primary Mouse Hippocampal Neurons and Neuro2a Cells. [Abstract]2021 Nov 22;9:771508. PMID: 34881219
BDNF Protein, Human/Mouse/Rat purchased from MedChemExpress. Usage Cited in: Front Public Health. 2021 Nov 22;9:771508. [Abstract]
Example images of primary hippocampal neruons were taken with a 20✕ optical microscope and recognized by ImageJ software. BDNF Protein (40 ng/ml) was incubated with primary hippocampal neurons for 48 hours as a positive control. MEK1/2 inhibitor PD98059 (50μM) was treated neurons for 48 hours as a negative control. BDNF treatment of primary hippocampal neurons could increase the average neurites length by 50% compared with sham, and could promote the number of primary neurites. However, PD98059 treatment of inhibited average neurites length by about 60%, and decreased the number of primary, secondary neurites and branch points per neuron.
-
IUBMB Life
Neuroprotective effects of resveratrol through modulation of PI3K/Akt/GSK-3β pathway and metalloproteases. [Abstract]2024 Dec;76(12):1199-1208. PMID: 39159067 -
-
-
Technical Parameters
-
Species Mouse; Rat; Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P23560-1 (H129-R247)/P21237-1 (H131-R249)/P23363 (H131-R249)
-
Molecular Construction
-
N-term
-
BDNF (H129-R247)
Accession # P23560 -
C-term
-
-
Protein Length
Full Length of Neurotrophic factor BDNF Chain
-
Synonyms
BDNF; Abrineurin; Brain Derived Neurotrophic Factor; Brain-Derived Neurotrophic Factor Preproprotein Isoform 2; ProBDNF; Brain-Derived Neurotrophic Factor Isoform 1; Neurotrophic Factor BDNF Precursor Form; ANON2; Brain-Derived Neurotrophic Factor; BULN2;
-
AA Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 14-19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 400 mM NaCl,pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11(6):1164-78. [Content Brief]
[2]. Li M, et al. Recombinant human brain-derived neurotrophic factor prevents neuronal apoptosis in a novel in vitro model of subarachnoid hemorrhage. Neuropsychiatr Dis Treat. 2017 Apr 3;13:1013-1021. [Content Brief]
[3]. Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56(5):3295-3312. [Content Brief]
[4]. Hang P, et al. Brain-derived neurotrophic factor attenuates doxorubicin-induced cardiac dysfunction through activating Akt signalling in rats. J Cell Mol Med. 2017 Apr;21(4):685-696. [Content Brief]
[5]. Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112(2):257-69. [Content Brief]
[6]. Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22(5-6):663-74. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)