Copy Link Print Information

PDGF-BB Protein, Human

29 Cited Publications
Customer Review

Based on 29 publication(s) in Google Scholar

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • PDGF-BB Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

Background

Recombinant Human Platelet-derived Growth Factor-BB is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization[1]. Recombinant Human Platelet-derived Growth Factor-BB (rhPDGF-BB) accelerates tendon healing by improving matrix remodeling, increased collagen synthesis, and increased cell proliferation. Recombinant Human Platelet-derived Growth Factor-BB is also efficacious in a non-ruptured, degenerated, tendinopathy model. Furthermore, Recombinant Human Platelet-derived Growth Factor-BB addresses chronic tendinopathies by inducing proliferation and migration of progenitor cells and tenocytes, which stimulate structural repair of the degenerated tendon[2].

In Vitro

PDGF-BB Protein, Human (7.5 ng/mL-7.5 µg/mL) significantly enhances the proliferation of human foreskin fibroblasts[4].
PDGF-BB Protein, Human (10 ng/mL; 0-24 h) promotes the migration of rat bone marrow mesenchymal stem cells (rBM MSC)[5].
PDGF-BB Protein, Human (50 ng/mL; 2-4 h) upregulates the gene expression of CCL2 and CCL7 in mouse 10T1/2 cells[6].

In Vivo

PDGF-BB Protein, Human (3-10 μg; intra-tendon injection) improves maximum load-to-rupture and stiffness in a rat Achilles tendinopathy model induced by collagenase[2].
PDGF-BB Protein, Human (3 mg/wound; topical application; once daily; 10 d) does not accelerate wound closure, re-epithelialization, or collagen deposition in a splinted full-thickness skin wound model in db/db diabetic mice[4].

Verified Bioactivity

The ED50 is ≤11 ng/mL as measured by murine Balb/c 3T3 cells.

Results
  • Experimental Validation Results for PDGF-BB Protein, Human
    Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.81 ng/mL, corresponding to a specific activity is 5.54×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01127-1 (S82-T190)

  • Gene ID
    5155  [NCBI]
  • Molecular Construction
    • N-term
    • PDGF-BB (S82-T190)
      Accession # P01127-1
    • C-term
  • Protein Length

    Full Length of PDGFB

  • Synonyms

    rHuPDGF-BB; PDGF-2; GDGF; ODGF; SIS; SSV

  • AA Sequence

    SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

  • Predicted Molecular Mass

    12.4 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for PDGF-BB Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM NaAC-HAC, 4% mannitol, pH 4.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, 500 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23(1):32-39. [Content Brief]

[2]. Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32(1):145-50. [Content Brief]

[3]. Chen L, et al. Inhibition of PDGF-BB reduces alkali-induced corneal neovascularization in mice. Mol Med Rep. 2021 Apr;23(4):238. [Content Brief]

[4]. Park SA, et al. PDGF-BB does not accelerate healing in diabetic mice with splinted skin wounds. PLoS One. 2014 Aug 14;9(8):e104447. [Content Brief]

[5]. Chung R, et al. Potential roles of growth factor PDGF-BB in the bony repair of injured growth plate. Bone. 2009 May;44(5):878-85. [Content Brief]

[6]. Au P, et al. Paradoxical effects of PDGF-BB overexpression in endothelial cells on engineered blood vessels in vivo. Am J Pathol. 2009 Jul;175(1):294-302. [Content Brief]

[7]. Cao H, et al. PDGF-BB prevents destructive repair and promotes reparative osteogenesis of steroid-associated osteonecrosis of the femoral head in rabbits. Bone. 2023 Feb;167:116645. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.81 ng/mL, corresponding to a specific activity is 5.54×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.81 ng/mL, corresponding to a specific activity is 5.54×105 units/mg.

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Free Radic Biol Med. 2025 Nov 8:243:414-433. [Abstract]

    Customer Validation
     PASMCs were stimulated with 0, 5, or 10 ng/mL PDGF-BB for 24 h. qPCR analysis of TRIB2 mRNA expression in PASMCs.

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Free Radic Biol Med. 2025 Nov 8:243:414-433. [Abstract]

    Customer Validation
     PASMCs were stimulated with 0, 5, or 10 ng/mL PDGF-BB for 24 h. Representative Western blot and quantitative analysis of TRIB2, PCNA, BCL2, and BAX protein expression in PASMCs.

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Free Radic Biol Med. 2025 Nov 8:243:414-433. [Abstract]

    Customer Validation
     PASMCs were stimulated with 0 or 10 ng/mL PDGF-BB for 24 h. Representative fluorescence images and quantitative analysis of EdU (red) incorporation in PASMCs (n = 3). Nuclei were stained with DAPI (blue).

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Free Radic Biol Med. 2025 Nov 8:243:414-433. [Abstract]

    Customer Validation
     PASMCs were stimulated with 0 or 10 ng/mL PDGF-BB for 24 h. Representative images and quantitative analysis of the Transwell assay (n = 3). Scale bar = 300 μm.

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Free Radic Biol Med. 2025 Nov 8:243:414-433. [Abstract]

    Customer Validation
     PASMCs were stimulated with 0 or 10 ng/mL PDGF-BB for 24 h. Representative flow cytometry plots and quantitative analysis of apoptosis using Annexin V-FITC/PI double staining (n = 3).

  • 1/16

    PDGF-BB Protein, Human purchased from MedChemExpress. Usage Cited in: Bone Res. 2024 Apr 10;12(1):24. [Abstract]

    Customer Validation
     Representative images display capillary-like structures formed by OPLL-derived ligament cells on Matrigel under distinct conditions: unstimulated (Blank), ddH2O (Vehicle), and PDGF-BB (100 ng/mL, 4-6 h). Scale bar = 100 μm.

  • PDGF-BB Protein, Human Product Image
    1/16
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • Experimental Validation Results for PDGF-BB Protein, Human
  • PDGF-BB Protein, Human Product Image