PDGF-BB Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
PDGF-BB, a crucial growth factor, regulates diverse cellular processes, including development, proliferation, migration, survival, and chemotaxis. It is vital for tissue proliferation, blood vessel development, and kidney glomeruli formation. PDGF-BB interacts with PDGFRA, PDGFRB, XLKD1, LRP1, and SORL1, highlighting its versatile cellular involvement. PDGF-BB Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PDGF-BB, a crucial growth factor, regulates diverse cellular processes, including development, proliferation, migration, survival, and chemotaxis. It is vital for tissue proliferation, blood vessel development, and kidney glomeruli formation. PDGF-BB interacts with PDGFRA, PDGFRB, XLKD1, LRP1, and SORL1, highlighting its versatile cellular involvement. PDGF-BB Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
Background
PDGF-BB, a crucial growth factor, assumes a central role in regulating diverse cellular processes, encompassing embryonic development, cell proliferation, migration, survival, and chemotaxis. As a potent mitogen for mesenchymal cells, PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. It is essential for blood vessel development and the formation of kidney glomeruli, highlighting its multifaceted contributions to tissue homeostasis. Furthermore, PDGF-BB plays a pivotal role in wound healing. The intricacies of its signaling are modulated by the formation of antiparallel homodimers, linked by disulfide bonds, and antiparallel heterodimers with PDGFA. These dynamic dimers engage in intricate interactions with PDGFRA and PDGFRB homodimers, as well as heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-BB interacts with XLKD1, LRP1, and SORL1, further emphasizing its versatile involvement in cellular regulation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human PDGFRB at 2 μg/mL (100 μl/well) can bind Mouse PDGF-B His, the EC50 of Mouse PDGF-B His is 4-24 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-His
-
Accession
AAH23427.1 (S60-T168)
-
Molecular Construction
-
N-term
-
His
-
PDGF-BB (S60-T168)
Accession # AAH23427.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 30 % CAN, 0.1 % TFA.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)