PDGF-BB Protein, Mouse (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

PDGF-BB, a crucial growth factor, regulates diverse cellular processes, including development, proliferation, migration, survival, and chemotaxis. It is vital for tissue proliferation, blood vessel development, and kidney glomeruli formation. PDGF-BB interacts with PDGFRA, PDGFRB, XLKD1, LRP1, and SORL1, highlighting its versatile cellular involvement. PDGF-BB Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDGF-BB, a crucial growth factor, regulates diverse cellular processes, including development, proliferation, migration, survival, and chemotaxis. It is vital for tissue proliferation, blood vessel development, and kidney glomeruli formation. PDGF-BB interacts with PDGFRA, PDGFRB, XLKD1, LRP1, and SORL1, highlighting its versatile cellular involvement. PDGF-BB Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGF-BB, a crucial growth factor, assumes a central role in regulating diverse cellular processes, encompassing embryonic development, cell proliferation, migration, survival, and chemotaxis. As a potent mitogen for mesenchymal cells, PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. It is essential for blood vessel development and the formation of kidney glomeruli, highlighting its multifaceted contributions to tissue homeostasis. Furthermore, PDGF-BB plays a pivotal role in wound healing. The intricacies of its signaling are modulated by the formation of antiparallel homodimers, linked by disulfide bonds, and antiparallel heterodimers with PDGFA. These dynamic dimers engage in intricate interactions with PDGFRA and PDGFRB homodimers, as well as heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-BB interacts with XLKD1, LRP1, and SORL1, further emphasizing its versatile involvement in cellular regulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human PDGFRB at 2 μg/mL (100 μl/well) can bind Mouse PDGF-B His, the EC50 of Mouse PDGF-B His is 4-24 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PDGF-BB (S60-T168)
      Accession # AAH23427.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth

  • AA Sequence

    SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

  • Predicted Molecular Mass

    14.2 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 30 % CAN, 0.1 % TFA.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00