PDGF-BB Protein, Rat

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Platelet derived growth factor (PDGF) is a potent mitogen and chemoattractant for mesenchymal and osteogenic cells and stimulates angiogenic molecules which play an essential role in bone regeneration^[1]. Platelet-Derived Growth Factor-BB is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor. PDGF-BB exerts beneficial effects on haemorrhagic shock, which are closely related to targeting CX43 to improve vascular reactivity and haemodynamics. PDGF-BB functions in corporal cavernosum smooth muscle cells (CCSMCs) via binding to PDGFR^[2].

The ED₅₀ is <2 ng/mL as measured by Balb/c 3T3 cells, corresponding to a specific activity of >5.0 × 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED₅₀ for this effect is 1.528 ng/mL, corresponding to a specific activity is 6.544×10⁵ units/mg.

Rat

E. coli

Tag Free

Q05028 (S74-T182)

24628  [NCBI]

Full Length of Mature Protein

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM acetic acid.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20mM HAc. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Badwelan M, et al. The Efficacy of Recombinant Platelet-Derived Growth Factor on Beta-Tricalcium Phosphate to Regenerate Femoral Critical Sized Segmental Defects: Longitudinal In Vivo Micro-CT Study in a Rat Model. J Invest Surg. 2018 Nov 15:1-13.  [Content Brief]

  [2]. Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.  [Content Brief]