1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-BB
  6. PDGF-BB Protein, Rat

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    PDGF-BB Protein, Rat purchased from MCE. Usage Cited in: Phytomedicine. 2023 Jul 25:116:154891.  [Abstract]

    PDGF-BB Protein, Rat (20 ng/mL) increased the proliferation of VSMCs by approximately 30%.

    PDGF-BB Protein, Rat purchased from MCE. Usage Cited in: Phytomedicine. 2023 Jul 25:116:154891.  [Abstract]

    The Wound healing assay revealed that PDGF-BB Protein, Rat (20 ng/mL) induced VSMC migration.

    PDGF-BB Protein, Rat purchased from MCE. Usage Cited in: Phytomedicine. 2023 Jul 25:116:154891.  [Abstract]

    PDGF-BB Protein, Rat (20 ng/mL) induced increased levels of PCNA and MMP9 and a decreased level of CALPONIN in VSMCs.

    PDGF-BB Protein, Rat purchased from MCE. Usage Cited in: Phytomedicine. 2023 Jul 25:116:154891.  [Abstract]

    PDGF-BB Protein, Rat (20 ng/mL) significantly increased intracellular Ca2+ levels in VSMCs.

    PDGF-BB Protein, Rat purchased from MCE. Usage Cited in: Phytomedicine. 2023 Jul 25:116:154891.  [Abstract]

    PDGF-BB Protein, Rat (20 ng/mL) induction increased the expression of PLCγ1, MMP9, and PCNA in VSMCs.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

    Background

    Platelet derived growth factor (PDGF) is a potent mitogen and chemoattractant for mesenchymal and osteogenic cells and stimulates angiogenic molecules which play an essential role in bone regeneration[1]. Platelet-Derived Growth Factor-BB is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor. PDGF-BB exerts beneficial effects on haemorrhagic shock, which are closely related to targeting CX43 to improve vascular reactivity and haemodynamics. PDGF-BB functions in corporal cavernosum smooth muscle cells (CCSMCs) via binding to PDGFR[2].

    Biological Activity

    The ED50 is <2 ng/mL as measured by Balb/c 3T3 cells, corresponding to a specific activity of >5.0 × 105 units/mg.

    • Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.528 ng/mL, corresponding to a specific activity is 6.544×105 units/mg.
    Species

    Rat

    Source

    E. coli

    Tag

    Tag Free

    Accession

    Q05028 (S74-T182)

    Gene ID
    Molecular Construction
    N-term
    PDGF-BB (S74-T182)
    Accession # Q05028
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rRtPDGF-BB; PDGF-2; Pdgfb
    AA Sequence

    SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

    Predicted Molecular Mass
    24.6 kDa
    Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under non reducing (N) conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM acetic acid.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20mM HAc. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    PDGF-BB Protein, Rat Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    PDGF-BB Protein, Rat

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    PDGF-BB Protein, Rat
    Cat. No.:
    HY-P7278
    Quantity:
    MCE Japan Authorized Agent: