1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGF & PDGFR
  4. PDGF
  5. PDGF-BB Protein, Rat

PDGF-BB Protein, Rat

Cat. No.: HY-P7278
Handling Instructions

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $290 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

PDGF-BB Protein, Rat Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q05028 (S74-T182)

Gene ID

24628

Synonyms
rRtPDGF-BB; PDGF-2; Pdgfb
AA Sequence

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Weight

Approximately 24.6 kDa

Biological Activity
The ED50 is <2 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >5.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM acetic acid.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Platelet derived growth factor (PDGF) is a potent mitogen and chemoattractant for mesenchymal and osteogenic cells and stimulates angiogenic molecules which play an essential role in bone regeneration[1]. Platelet-Derived Growth Factor-BB is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor. PDGF-BB exerts beneficial effects on haemorrhagic shock, which are closely related to targeting CX43 to improve vascular reactivity and haemodynamics. PDGF-BB functions in corporal cavernosum smooth muscle cells (CCSMCs) via binding to PDGFR[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Rat
Cat. No.:
HY-P7278
Quantity:
MCE Japan Authorized Agent: