VEGF164 Protein, Rat (P.pastoris)

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (P.pastoris) is the recombinant rat-derived VEGF164 protein, expressed by P. pastoris , with tag free and A36T mutation.

VEGF164, a growth factor with pivotal roles in angiogenesis, vasculogenesis, and endothelial cell growth, orchestrates a range of cellular responses crucial for vascular development. It stimulates endothelial cell proliferation, facilitates cell migration, prevents apoptosis, and enhances blood vessel permeability by binding to receptors such as FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. During lactation, VEGF164 may contribute to increased vascular permeability, supporting efficient transport of molecules for milk protein synthesis. Additionally, its interaction with the NRP1 receptor initiates signaling pathways essential for motor neuron axon guidance and cell migration, underscoring its involvement in embryonic development processes. Existing as a homodimer with disulfide linkage, VEGF164 also forms a heterodimer with PGF and interacts with isoform 2 of BSG, revealing its multifaceted molecular interactions.

1.Rat VEGFR-1 (HY-P73552) immobilized on CM5 Chip can bind Rat VEGF164 with an affinity constant of 16.4 pM as determined in a SPR assay.
2.Immobilized Rat VEGF 164 at 2 μg/mL (100 μL/well) can bind Mouse VEGFR2-Fc.The ED₅₀ of Mouse VEGFR2-Fc is 22.17 ng/mL.

• 
  Rat VEGFR-1 (HY-P73552) immobilized on CM5 Chip can bind Rat VEGF164 with an affinity constant of 16.4 pM as determined in a SPR assay.

Rat

P. pastoris

Tag Free

P16612-2 (A27-R190, A36T)

83785  [NCBI]

Partial

APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.