2. Others
  3. Fluorescent Dye
  4. Exendin-4, Cy5 labeled

Exendin-4, Cy5 labeled  (Synonyms: Exendin-4-Cys(Cy5))

Cat. No.: HY-13443F2 Purity: 97.16%
COA
SDS
Handling Instructions Technical Support

Exendin-4, Cy5-labeled (Exendin-4-Cys(Cy5)) is a covalently linked Cy5 fluorescent group to Exendin-4 (HY-13443), a GLP-1 receptor agonist. Exendin-4, Cy5-labeled enables the visualization imaging of β cells in vivo, especially for evaluating the expression dynamics of GLP-1R in type 2 diabetes models.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin-4, Cy5 labeled

Exendin-4, Cy5 labeled Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Exendin-4, Cy5 labeled Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin-4, Cy5-labeled (Exendin-4-Cys(Cy5)) is a covalently linked Cy5 fluorescent group to Exendin-4 (HY-13443), a GLP-1 receptor agonist. Exendin-4, Cy5-labeled enables the visualization imaging of β cells in vivo, especially for evaluating the expression dynamics of GLP-1R in type 2 diabetes models[1].

Molecular Weight

4931.02

Formula

C225H332ClN55O64S2
Appearance

Solid

Color

Blue to dark blue

Sequence

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-{Cys-Mal-CY5}-NH2
Sequence Shortening

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-{Cys-Mal-CY5}-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (20.28 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2028 mL 1.0140 mL 2.0280 mL
5 mM 0.0406 mL 0.2028 mL 0.4056 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2028 mL 1.0140 mL 2.0280 mL 5.0699 mL
5 mM 0.0406 mL 0.2028 mL 0.4056 mL 1.0140 mL
10 mM 0.0203 mL 0.1014 mL 0.2028 mL 0.5070 mL
15 mM 0.0135 mL 0.0676 mL 0.1352 mL 0.3380 mL
20 mM 0.0101 mL 0.0507 mL 0.1014 mL 0.2535 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Exendin-4, Cy5 labeled Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Exendin-4, Cy5 labeledExendin-4-Cys(Cy5)Fluorescent Dyeexendin-4GLP-1 receptorimagingisletstype 2 diabetesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin-4, Cy5 labeled
Cat. No.:
HY-13443F2
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.