1. Others
  2. Thyroid Hormone Receptor
  3. Parathyroid hormone (1-34) (rat)

Parathyroid hormone (1-34) (rat) 

Cat. No.: HY-P2279
Handling Instructions

Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Parathyroid hormone (1-34) (rat) Chemical Structure

Parathyroid hormone (1-34) (rat) Chemical Structure

CAS No. : 98614-76-7

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.

Molecular Weight

4057.71

Formula

C₁₈₀H₂₉₁N₅₅O₄₈S₂

CAS No.

98614-76-7

Sequence

Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Sequence Shortening

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Parathyroid hormone (1-34) (rat)Thyroid Hormone ReceptorTHRInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Parathyroid hormone (1-34) (rat)
Cat. No.:
HY-P2279
Quantity:
MCE Japan Authorized Agent: