Parathyroid hormone (1-34) (rat)
Based on 2 publication(s) in Google Scholar
Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.
For research use only. We do not sell to patients.
- Purity: 98.59%
- CAS No.: 98614-76-7
- Formula: C180H291N55O48S2
- Molecular Weight:4057.71
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Parathyroid hormone (1-34) (rat)
More
Biological Activity
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:ovariectomized (Ovx) rats[1]
-
Dosage:40 mg/kg
-
Administration:s.c, per day, for 4 weeks
-
Result:Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals.
Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment.
Chemical Information
-
CAS No. 98614-76-7
-
Appearance Solid
-
Molecular Weight 4057.71
-
Formula C180H291N55O48S2
-
Color White to light yellow
-
Sequence
Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
-
Sequence Shortening
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Biochem Pharmacol
Irisolidone enhances osteoblast differentiation via the AMPK-ULK1-autophagy Axis to accelerate osteoporotic fracture repair. [Abstract]2025 Aug 13;242(Pt 1):117234. PMID: 40816626 -
Am J Stem Cells
Parathyroid hormone enhances the therapeutic effect of mesenchymal stem cells on temporomandibular joint osteoarthritis in rats. [Abstract]2023 Oct 20;12(4):73-82. PMID: 38021454
Solvent & Solubility
H2O : 100 mg/mL (24.64 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (284 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. V Shen, et al. Loss of cancellous bone mass and connectivity in ovariectomized rats can be restored by combined treatment with parathyroid hormone and estradiol. J Clin Invest. 1993 Jun;91(6):2479-87. [Content Brief]
[2]. Yebin Jiang, et al. Recombinant human parathyroid hormone (1-34) [teriparatide] improves both cortical and cancellous bone structure. J Bone Miner Res. 2003 Nov;18(11):1932-41. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2464 mL | 1.2322 mL | 2.4644 mL | 6.1611 mL |
| 5 mM | 0.0493 mL | 0.2464 mL | 0.4929 mL | 1.2322 mL | |
| 10 mM | 0.0246 mL | 0.1232 mL | 0.2464 mL | 0.6161 mL | |
| 15 mM | 0.0164 mL | 0.0821 mL | 0.1643 mL | 0.4107 mL | |
| 20 mM | 0.0123 mL | 0.0616 mL | 0.1232 mL | 0.3081 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Parathyroid hormone (1-34) (rat) Related Classifications
HY-P2279 Related Classifications
Powered by Bioz