14-3-3 sigma Protein, Mouse

Customer Review

Based on 1 Customer Validation

14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.

Background

The 14-3-3 sigma protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Particularly, when bound to KRT17, it plays a role in regulating protein synthesis and epithelial cell growth by stimulating the Akt/mTOR pathway. Additionally, it may regulate MDM2 autoubiquitination and degradation, leading to the activation of p53/TP53. Existing as a homodimer, 14-3-3 sigma is found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35, and it interacts with various proteins, including GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (leading to proteasomal degradation), the 'Thr-369' phosphorylated form of DAPK2, PI4KB, SLITRK1, and LRRK2 (dependent on LRRK2 phosphorylation). These diverse interactions highlight the versatile role of 14-3-3 sigma in orchestrating various cellular processes and signaling events.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 14-3-3σ (M1-S248)
      Accession # O70456
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SFN; 14-3-3 Protein Sigma; Stratifin; 14-3-3 Sigma; YWHAS; HME1; Epithelial Cell Marker Protein 1

  • AA Sequence

    MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00