14-3-3 sigma Protein, Mouse
Based on 1 Customer Validation
14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
14-3-3 sigma proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity. When bound to KRT17, it stimulates the regulation of protein synthesis and cell growth through the Akt/mTOR pathway. 14-3-3 sigma Protein, Mouse is the recombinant mouse-derived 14-3-3 sigma protein, expressed by E. coli , with tag free.
The 14-3-3 sigma protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Particularly, when bound to KRT17, it plays a role in regulating protein synthesis and epithelial cell growth by stimulating the Akt/mTOR pathway. Additionally, it may regulate MDM2 autoubiquitination and degradation, leading to the activation of p53/TP53. Existing as a homodimer, 14-3-3 sigma is found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, and VPS35, and it interacts with various proteins, including GAB2, KRT17, SAMSN1, SRPK2, COPS6, COP1 (leading to proteasomal degradation), the 'Thr-369' phosphorylated form of DAPK2, PI4KB, SLITRK1, and LRRK2 (dependent on LRRK2 phosphorylation). These diverse interactions highlight the versatile role of 14-3-3 sigma in orchestrating various cellular processes and signaling events.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
O70456 (M1-S248)
-
Molecular Construction
-
N-term
-
14-3-3σ (M1-S248)
Accession # O70456 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SFN; 14-3-3 Protein Sigma; Stratifin; 14-3-3 Sigma; YWHAS; HME1; Epithelial Cell Marker Protein 1
-
AA Sequence
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
