2B4/CD244 Protein, Mouse (HEK293, His)
The CD244 protein is an activating receptor that regulates NK cells and CD8+ T cells. It enhances NK cell cytotoxicity, IFN-γ production, and granule exocytosis. 2B4/CD244 Protein, Mouse (HEK293, His) is the recombinant mouse-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD244 protein is an activating receptor that regulates NK cells and CD8+ T cells. It enhances NK cell cytotoxicity, IFN-γ production, and granule exocytosis. 2B4/CD244 Protein, Mouse (HEK293, His) is the recombinant mouse-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The function of CD244 is to regulate the activity of natural killer (NK) cells and CD8+ T-cells. It acts as an activating receptor for NK cells, stimulating their cytotoxicity, production of IFN-gamma, and granule exocytosis. CD244 also enhances signals from other NK receptors, such as NCR3 and NCR1, to further activate NK cells. It is involved in the regulation of CD8+ T-cell proliferation and provides costimulatory-like function for neighboring T-cells. CD244 can also inhibit inflammatory responses in dendritic cells. The presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and SH2D1B/EAT-2, control the activity of CD244. It interacts with various proteins, including SH2D1A, FYN, VAV1, INPP5D/SHIP1, CBL, PTPN6/SHP-1, PTPN11/SHP-2, CSK, and MHC class I proteins. The interaction with CD48 is important for its function, and engagement of CD244 with CD48 expressed on neighboring NK cells is crucial for optimal expansion and activation of NK cells.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q07763-1 (Q20-N221)
-
Molecular Construction
-
N-term
-
2B4/CD244 (Q20-N221)
Accession # Q07763-1 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD244; Signaling Lymphocytic Activation Molecule 4; CD244 Molecule; NK Cell Type I Receptor Protein 2B4; NKR2B4; NK Cell Activation-Inducing Ligand; SLAMF4; SLAM Family Member 4; NAIL; H2B4; 2B4; NK Cell Activation Inducing Ligand NAIL; Natural Killer Cel
-
AA Sequence
QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSN
-
Predicted Molecular Mass
23.5 kDa
-
Molecular Weight
Approximately 35-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
