ALK-7 Protein, Mouse (HEK293, His)

ALK-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ALK-7 protein, expressed by HEK293, with C-8*His tag.

ALK-7 is a serine/threonine protein kinase that forms a receptor complex upon ligand binding. The receptor complex consists of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate and bind to activate SMAD transcriptional regulators SMAD2 and SMAD3. ALK-7 serves as a receptor for activin AB, activin B, activin E, and NODAL. Upon binding to NODAL, ALK-7 activation leads to increased apoptosis and reduced proliferation by suppressing AKT signaling and activating the Smad2-dependent signaling pathway in pancreatic beta-cells, trophoblasts, epithelial cells, or neuronal cells. Additionally, ALK-7 acts as a positive regulator for macrophage activation, partially by downregulating PPARG expression.

1.This product does not contain protein kinase domain.
2.Immobilized Mouse ALK-7, His Tag at 0.5 μg/mL(100 μL/well) on the plate. Dose response curve for Anti-ALK7 Antibody, hFc Tag with the EC₅₀ of 3.7 ng/mL determined by ELISA.

Mouse

HEK293

C-8*His

Q8K348 (L26-E113)

269275

Partial

LKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPRLGPTE

Approximately 20-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl (pH 7.5), 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.