Apolipoprotein E/APOE4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Apolipoprotein E/APOE4 Protein, Human (HEK293, His) is the recombinant human-derived Apolipoprotein E/APOE4 protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Apolipoprotein E/APOE4 Protein, Human (HEK293, His) is the recombinant human-derived Apolipoprotein E/APOE4 protein, expressed by HEK293, with N-His labeled tag.

Background

Apolipoprotein E (APOE) is a lipid-associated protein that primarily facilitates lipoprotein-mediated lipid transport between organs through plasma and interstitial fluids. As a core component of plasma lipoproteins, APOE participates in their production, conversion, and clearance. This amphipathic molecule interacts with both lipoprotein core lipids and the aqueous plasma environment, binding to chylomicrons, chylomicron remnants, VLDL, and IDL while showing preferential affinity for HDL. APOE engages with cellular receptors including LDLR, LRP1/LRP2/LRP8, and VLDLR to mediate cellular uptake of APOE-containing lipoprotein particles. Its heparin-binding activity enables interaction with cell-surface heparan sulfate proteoglycans, facilitating lipoprotein capture and receptor-mediated endocytosis. A key function involves hepatic clearance of chylomicrons, VLDL, and HDL. APOE contributes to VLDL biosynthesis in the liver and subsequent peripheral tissue uptake for triglyceride delivery and energy storage. It maintains systemic lipid homeostasis by coordinating inter-tissue lipid distribution and participates in reverse cholesterol transport via HDL biogenesis (with ABCA1) and hepatic HDL uptake. In the central nervous system, APOE regulates lipid transport, neuronal survival, and sprouting. The protein also modulates innate/adaptive immune responses (by similar) through interactions with LILRB4 and may influence transcription via a cholesterol-independent mechanism activating MAP3K12 and non-canonical MAPK signaling to enhance AP-1-mediated APP expression.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • APOE4 (K19-H317)
      Accession # AAB59397.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5

  • AA Sequence

    KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 2mM DTT, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00