1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE4 Protein, Human (HEK293, His)

Apolipoprotein E/APOE4 Protein, Human (HEK293, His)

Cat. No.: HY-P700853
Handling Instructions Technical Support

Apolipoprotein E/APOE4 Protein, Human (HEK293, His) is the recombinant human-derived Apolipoprotein E/APOE4 protein, expressed by HEK293, with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Apolipoprotein E/APOE4 Protein, Human (HEK293, His) is the recombinant human-derived Apolipoprotein E/APOE4 protein, expressed by HEK293, with N-His labeled tag.

Background

Apolipoprotein E (APOE) is a lipid-associated protein that primarily facilitates lipoprotein-mediated lipid transport between organs through plasma and interstitial fluids. As a core component of plasma lipoproteins, APOE participates in their production, conversion, and clearance. This amphipathic molecule interacts with both lipoprotein core lipids and the aqueous plasma environment, binding to chylomicrons, chylomicron remnants, VLDL, and IDL while showing preferential affinity for HDL. APOE engages with cellular receptors including LDLR, LRP1/LRP2/LRP8, and VLDLR to mediate cellular uptake of APOE-containing lipoprotein particles. Its heparin-binding activity enables interaction with cell-surface heparan sulfate proteoglycans, facilitating lipoprotein capture and receptor-mediated endocytosis. A key function involves hepatic clearance of chylomicrons, VLDL, and HDL. APOE contributes to VLDL biosynthesis in the liver and subsequent peripheral tissue uptake for triglyceride delivery and energy storage. It maintains systemic lipid homeostasis by coordinating inter-tissue lipid distribution and participates in reverse cholesterol transport via HDL biogenesis (with ABCA1) and hepatic HDL uptake. In the central nervous system, APOE regulates lipid transport, neuronal survival, and sprouting. The protein also modulates innate/adaptive immune responses (by similar) through interactions with LILRB4 and may influence transcription via a cholesterol-independent mechanism activating MAP3K12 and non-canonical MAPK signaling to enhance AP-1-mediated APP expression.

Species

Human

Source

HEK293

Tag

N-8*His

Accession

AAB59397.1 (K19-H317)

Gene ID

348  [NCBI]

Molecular Construction
N-term
8*His
APOE4 (K19-H317)
Accession # AAB59397.1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Apolipoprotein E; Apo-E; APOE; apolipo E; APOE4
AA Sequence

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

분자량

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 2mM DTT, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Apolipoprotein E/APOE4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Apolipoprotein E/APOE4 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Apolipoprotein E/APOE4 Protein, Human (HEK293, His)
Cat. No.:
HY-P700853
수량:
MCE Japan Authorized Agent: