Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag^[1][2][3].

Apolipoprotein E/APOE is a member of the soluble apolipoprotein family, primarily synthesized in the liver and brain. Liver-derived Apolipoprotein E/APOE participates in peripheral lipid metabolism, while brain-derived Apolipoprotein E/APOE, produced by astrocytes, is involved in neuronal repair and synaptic plasticity. Apolipoprotein E/APOE plays a critical role in lipid transport within both plasma and the central nervous system by interacting with the low-density lipoprotein receptor family. The three common Apolipoprotein E/APOE isoforms (APOE2, APOE3, APOE4), differing in amino acids at positions 112 and 158, have distinct effects on the risk of diseases such as atherosclerosis and Alzheimer’s disease. Due to domain interactions and lower stability, APOE4 is a major genetic risk factor for Alzheimer’s disease, while APOE2 is associated with type III hyperlipoproteinemia due to weak receptor binding^[1][2][3].

1.Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED₅₀ this effect is 15-50 ng/mL.
2.Mouse TREM-2 immobilized on CM5 Chip can bind Mouse APOE with an affinity constant of 3.595 nM as determined in a SPR assay.
3.Immobilized Recombinant Mouse ApoE (C-6His) at 2 μg/ml (100 μl/well) can bind Recombinant Human TREM2 (C-Fc). The ED₅₀ of Recombinant Human TREM2 (C-Fc) is 8.05-34.77 ng/ml.

• 
  Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED₅₀ for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×10⁴ units/mg.

Mouse

HEK293

C-6*His

P08226 (E19-Q311)

11816  [NCBI]

Full Length of Mature Protein

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Approximately 34-40 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Gong JS, et al. Novel action of apolipoprotein E (ApoE): ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Mol Neurodegener. 2007 May 15;2:9.  [Content Brief]

  [2]. Hatters DM, et al. Apolipoprotein E structure: insights into function. Trends Biochem Sci. 2006 Aug;31(8):445-54.

  [3]. Eichner JE, et al. Apolipoprotein E polymorphism and cardiovascular disease: a HuGE review. Am J Epidemiol. 2002 Mar 15;155(6):487-95.  [Content Brief]