APRIL/TNFSF13 Trimer Protein, Human (HEK293, Flag-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Human (HEK293, Flag-His) is produced by HEK293 cells (K112-L250) with N-terminal 6*His and Flag tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Human (HEK293, Flag-His) is produced by HEK293 cells (K112-L250) with N-terminal 6*His and Flag tag.

Background

APRIL/TNFSF13 Protein is a cytokine and an independent secretory ligand belongs to TNF family. It binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. APRIL/TNFSF13 Protein plays a role in the regulation of tumor cell growth, may involve in monocyte/macrophage-mediated immunological processes[1].
APRIL is produced by myeloid cells and their precursors in the bone marrow. APRIL is retained by surrounding tissues and via HSPG (heparan sulfate proteoglycans) is not retained. It accumulates in large amounts in the bone marrow, leading to more rapid cell maturation and peripheral burst. As for infection response, tonsil mucosa neutrophils present within the infected tissue were the main source of APRIL, whereas keratinocytes were the primary source of APRIL in tissues showing no symptoms of infection[2].
APRIL acts function by binding BCMA (B cell maturation antigen) and TACI (transmembrane activator and CAML-interactor) and competes with TALL-I (also called BLyS or BAFF) for receptor binding. Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B cells, and soluble BCMA is a dominant-negative molecule capable of inhibiting antibody production in vivo. Thus, APRIL stimulates in vitro the proliferation of primary lymphocytes, in addition to lymphoma cell lines, and promotes in vivo the accumulation of B cells in the spleen. Therefore, APRIL-TALL-I and BCMA-TACI form a two ligands-two receptors pathway involved in stimulation of B and T cell function. Moreover, APRIL is also a stimulator of tumor cell growth although TNRF death ligand-1 (TRDL-1), which induces tumor cell apoptosis[1].
It is a type II membrane protein with a cytoplasmic domain, a hydrophobic transmembrane region, and an extracellular domain[2]. Mouse and human APRIL proteins are 82% identical in the COOH-terminal part of the extracellular domain, which contains the presumed receptor-binding domain. And the protein sequences of human and mouse are different with similarity of 80.91%. The APRIL protein is most often studied in the context of lymphoid malignancies[1].

In Vitro

APRIL (human; 1 ng/mL; 48 h; 37 ℃) prominently restores colorectal cancer (CRC) cell migration and invasion while APRIL knockdown suppresses migration and invasion[3].
APRIL (human; 25 or 100 ng/mL; 72 h; 37 ℃) results in an increase in proliferation rate of normal adult astrocytes and in four of eight cell lines tested[4].

In Vivo

APRIL-transfected NIH-3T3 cells (105 cells; s.c.; single dose) show an increased rate of tumor growth in nude mice compared with the parental cell line, and induces tumors after only 3-4 weeks[5].

Verified Bioactivity

Immobilized Human APRIL-Flag-His at 1μg/mL (100 μL/well) can bind Cynomolgus BCMA-Fc.The ED50 of Cynomolgus BCMA-Fc is 4.23 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His;N-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Flag-6*His
    • APRIL (K112-L250)
      Accession # O75888
    • C-term
  • Protein Length

    Full Length of THD Domain

  • Synonyms

    TNFSF13; ZTNF2; TNF Superfamily Member 13; Tumor Necrosis Factor Ligand Superfamily Member 13 Epsilon; APRIL; Tumor Necrosis Factor-Related Death Ligand-1; Tumor Necrosis Factor Ligand Superfamily Member 13; Tumor Necrosis Factor Superfamily Member 13; A

  • AA Sequence

    KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

  • Predicted Molecular Mass

    50 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 1 M NaCl, pH 8.3.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00