1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. B Cell CD Proteins NK Cell CD Proteins Stem Cell CD Proteins Receptor Tyrosine Kinases
  4. CD117/c-KIT
  5. CD117/c-kit Protein, Human (141a.a, His)

CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.

Background

CD117/c-kit, a tyrosine-protein kinase, serves as a cell-surface receptor for the cytokine KITLG/SCF, playing a pivotal role in the orchestration of cellular processes such as cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KITLG/SCF, KIT activates diverse signaling pathways, leading to the phosphorylation of PIK3R1, PLCG1, SH2B2/APS, and CBL. The AKT1 signaling pathway is activated through the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Additionally, KIT transmits signals via GRB2, activating RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, KIT induces the activation of STAT family members STAT1, STAT3, STAT5A, and STAT5B. PLCG1 activation results in the production of diacylglycerol and inositol 1,4,5-trisphosphate. Protein phosphatases modulate KIT signaling, and the receptor undergoes rapid internalization and degradation. Activated KIT promotes phosphorylation events involving PTPN6/SHP-1, PTPRU, STAT1, STAT3, STAT5A, STAT5B, PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC, and SHC1.

Species

Human

Source

E. coli

Tag

N-His

Accession

P10721-1 (V50-Q190)

Gene ID
Molecular Construction
N-term
His
KIT (V50-Q190)
Accession # P10721-1
C-term
Protein Length

Partial

Synonyms
Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl
AA Sequence

VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

Predicted Molecular Mass
17.9 kDa
Molecular Weight

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD117/c-kit Protein, Human (141a.a, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD117/c-kit Protein, Human (141a.a, His)
Cat. No.:
HY-P74341
Quantity:
MCE Japan Authorized Agent: