CD117/c-kit Protein, Human (141a.a, His)
CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.
Background
CD117/c-kit, a tyrosine-protein kinase, serves as a cell-surface receptor for the cytokine KITLG/SCF, playing a pivotal role in the orchestration of cellular processes such as cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KITLG/SCF, KIT activates diverse signaling pathways, leading to the phosphorylation of PIK3R1, PLCG1, SH2B2/APS, and CBL. The AKT1 signaling pathway is activated through the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Additionally, KIT transmits signals via GRB2, activating RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, KIT induces the activation of STAT family members STAT1, STAT3, STAT5A, and STAT5B. PLCG1 activation results in the production of diacylglycerol and inositol 1,4,5-trisphosphate. Protein phosphatases modulate KIT signaling, and the receptor undergoes rapid internalization and degradation. Activated KIT promotes phosphorylation events involving PTPN6/SHP-1, PTPRU, STAT1, STAT3, STAT5A, STAT5B, PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC, and SHC1.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P10721-1 (V50-Q190)
-
Molecular Construction
-
N-term
-
His
-
KIT (V50-Q190)
Accession # P10721-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KIT; C-Kit Protooncogene; Prev. PBT; Platelet-Derived Growth Factor Receptor-Like Protein; Mast/Stem Cell Growth Factor Receptor Kit; Mast/Stem Cell Growth Factor Receptor Variant; SCFR; Proto-Oncogene Tyrosine-Protein Kinase Kit; V-Kit Hardy-Zuckerman 4
-
AA Sequence
VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
-
Predicted Molecular Mass
17.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)