CD117/c-kit Protein, Human (141a.a, His)

CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.

Background

CD117/c-kit, a tyrosine-protein kinase, serves as a cell-surface receptor for the cytokine KITLG/SCF, playing a pivotal role in the orchestration of cellular processes such as cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KITLG/SCF, KIT activates diverse signaling pathways, leading to the phosphorylation of PIK3R1, PLCG1, SH2B2/APS, and CBL. The AKT1 signaling pathway is activated through the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Additionally, KIT transmits signals via GRB2, activating RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, KIT induces the activation of STAT family members STAT1, STAT3, STAT5A, and STAT5B. PLCG1 activation results in the production of diacylglycerol and inositol 1,4,5-trisphosphate. Protein phosphatases modulate KIT signaling, and the receptor undergoes rapid internalization and degradation. Activated KIT promotes phosphorylation events involving PTPN6/SHP-1, PTPRU, STAT1, STAT3, STAT5A, STAT5B, PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC, and SHC1.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • KIT (V50-Q190)
      Accession # P10721-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KIT; C-Kit Protooncogene; Prev. PBT; Platelet-Derived Growth Factor Receptor-Like Protein; Mast/Stem Cell Growth Factor Receptor Kit; Mast/Stem Cell Growth Factor Receptor Variant; SCFR; Proto-Oncogene Tyrosine-Protein Kinase Kit; V-Kit Hardy-Zuckerman 4

  • AA Sequence

    VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

  • Predicted Molecular Mass

    17.9 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00