CD117/c-kit Protein, Human (141a.a, His)

CD117/c-kit is a tyrosine protein kinase receptor for KITLG/SCF that coordinates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon KITLG/SCF binding, CD117 activates the pathway and phosphorylates PIK3R1, PLCG1, SH2B2/APS, and CBL. CD117/c-kit Protein, Human (141a.a, His) is the recombinant human-derived CD117/c-kit protein, expressed by E. coli , with N-His labeled tag.

CD117/c-kit, a tyrosine-protein kinase, serves as a cell-surface receptor for the cytokine KITLG/SCF, playing a pivotal role in the orchestration of cellular processes such as cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KITLG/SCF, KIT activates diverse signaling pathways, leading to the phosphorylation of PIK3R1, PLCG1, SH2B2/APS, and CBL. The AKT1 signaling pathway is activated through the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Additionally, KIT transmits signals via GRB2, activating RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, KIT induces the activation of STAT family members STAT1, STAT3, STAT5A, and STAT5B. PLCG1 activation results in the production of diacylglycerol and inositol 1,4,5-trisphosphate. Protein phosphatases modulate KIT signaling, and the receptor undergoes rapid internalization and degradation. Activated KIT promotes phosphorylation events involving PTPN6/SHP-1, PTPRU, STAT1, STAT3, STAT5A, STAT5B, PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC, and SHC1.

Human

E. coli

N-His

P10721-1 (V50-Q190)

3815  [NCBI]

Partial

VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.