CD299 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CD299, a gene encoding a C-type lectin, plays crucial roles in cell adhesion and pathogen recognition. This receptor has broad specificity, recognizing a diverse array of pathogens with significant public health implications, including tuberculosis mycobacteria, Ebola, hepatitis C, HIV-1, influenza A, West Nile virus, and the SARS-CoV acute respiratory syndrome coronavirus. The protein structure comprises four distinct domains: a C-terminal carbohydrate recognition domain, a variable-length flexible tandem-repeat neck domain, a transmembrane region, and an N-terminal cytoplasmic domain involved in internalization. CD299 shares close sequence and functional similarities with its neighboring gene, CD209 (also known as DC-SIGN), though they differ in viral recognition and expression patterns. CD299 exhibits high expression in endothelial cells of the liver, lymph nodes, and placenta. Notably, polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. With biased expression observed in tissues such as the liver (RPKM 15.4) and lymph nodes (RPKM 9.8), CD299 emerges as a critical player in immune response and pathogen defense.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant ICAM-3 Protein（HY-P72921）is immobilized at 2 µg/mL (100 µL/well), can bind Recombinant Human CD299 Protein. The ED50 for this effect is 1.304 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9H2X3-1/NP_055072.3 (S78-E399)
-
Gene ID10332
-
Molecular Construction
-
N-term
-
hFc
-
CD299 (S78-E399)
Accession # NP_055072.3 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CLEC4M; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 2; Prev. CD209L; DC-SIGN-Related Protein; Prev. CD299; L-SIGN; DC-SIGNR; Liver/Lymph Node-Specific ICAM-3 Grabbing Non-Integrin; DC-SIGN2; Liver/Lymph Node-Specific ICAM-3-Grabbing Non-Integrin;
-
AA Sequence
SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
-
Predicted Molecular Mass
63.1 kDa
-
Molecular Weight
Approximately 65-77 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
