1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory immune checkpoint molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD40 Ligand/CD154
  5. CD40 Ligand
  6. CD40L/CD154/TRAP Protein, Mouse (HEK 293, His)

CD40L/CD154/TRAP Protein, Mouse (HEK 293, His)

Cat. No.: HY-P70808
Handling Instructions
Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
2 μg/mL (100 μL/well) of immobilized Human CD40-Fc can bind Human CD40LG-His with an ED50 value of 13.84 ng/mL.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

P27548 (M112-L260)

Gene ID
Synonyms
CD40 Ligand; CD40LG; HIGM1; T-B cell-activating molecule; T-BAM; TNFSF5; tumor necrosis factor (ligand) superfamily member 5; Tumor necrosis factor ligand superfamily member 5
AA Sequence

MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 200 mM NaCl, 0.1 mM EDTA, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40L/CD154/TRAP Protein, Mouse (HEK 293, His)
Cat. No.:
HY-P70808
Quantity:
MCE Japan Authorized Agent: