CG alpha Protein, Human (HEK293, His)
Based on 1 Customer Validation
The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The CG alpha protein serves as the shared alpha chain in the active heterodimeric glycoprotein hormones, including thyrotropin (TSH), lutropin (LH), follitropin (FSH), and choriogonadotropin (CG). These hormones bind to specific receptors on target cells, initiating downstream signaling pathways. The heterodimeric structure of these hormones involves the CG alpha chain, as described here, and a unique beta chain, which imparts biological specificity to each hormone. Specifically, TSH consists of CG alpha and TSH beta (TSHB), lutropin comprises CG alpha and LH beta (LHB), follitropin includes CG alpha and FSH beta (FSHB), and choriogonadotropin is composed of CG alpha and choriogonadotropin subunit beta (CGB).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P01215 (A25-S116)
-
Molecular Construction
-
N-term
-
CG alpha (A25-S116)
Accession # P01215 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CGA; Anterior Pituitary Glycoprotein Hormones Common Subunit Alpha; Glycoprotein Hormones, Alpha Polypeptide; Follicle-Stimulating Hormone Alpha Subunit; Glycoprotein Hormones Alpha Chain; Chorionic Gonadotropin, Alpha Polypeptide; GPA1; Follicle-Stimulat
-
AA Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
-
Predicted Molecular Mass
11 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
