Copy Link Print Information

CG alpha Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

CG alpha, a glycoprotein hormone subunit, contributes to chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone. While alpha subunits are identical, beta chains confer specificity. Encoded by this gene, CG alpha belongs to the glycoprotein hormones alpha chain family. Restrictedly expressed in the placenta (RPKM 388.3). Two transcript variants exist. CG alpha Protein, Human (HEK293) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CG alpha Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CG alpha, a glycoprotein hormone subunit, contributes to chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone. While alpha subunits are identical, beta chains confer specificity. Encoded by this gene, CG alpha belongs to the glycoprotein hormones alpha chain family. Restrictedly expressed in the placenta (RPKM 388.3). Two transcript variants exist. CG alpha Protein, Human (HEK293) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with tag free.

Background

CG alpha Protein, the encoded alpha subunit of the human glycoprotein hormones, including chorionic gonadotropin (CG), luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH), plays a pivotal role in forming noncovalent dimers with beta subunits, conferring biological specificity to each hormone. While the alpha subunits are identical across these hormones, their unique beta chains determine their distinct functions. CG alpha belongs to the glycoprotein hormones alpha chain family and is expressed predominantly in the placenta (RPKM 388.3). The restricted expression pattern highlights its specialization in placental tissues, where it contributes to the regulatory functions of glycoprotein hormones crucial for reproductive and endocrine processes. Two transcript variants, encoding different isoforms, have been identified for this gene, adding to the complexity of its regulatory mechanisms in various physiological contexts.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    NP_000726.1 (A25-S116)

  • Gene ID
    1081  [NCBI]
  • Molecular Construction
    • N-term
    • CG alpha (A25-S116)
      Accession # NP_000726.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CGA; Anterior Pituitary Glycoprotein Hormones Common Subunit Alpha; Glycoprotein Hormones, Alpha Polypeptide; Follicle-Stimulating Hormone Alpha Subunit; Glycoprotein Hormones Alpha Chain; Chorionic Gonadotropin, Alpha Polypeptide; GPA1; Follicle-Stimulat

  • AA Sequence

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

  • Molecular Weight

    Approximately 11.86&15-22 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CG alpha Protein, Human (HEK293) Product Image
    1/16
  • CG alpha Protein, Human (HEK293) Product Image