CLEC14A Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CLEC14A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CLEC14A protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLEC14A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CLEC14A protein, expressed by HEK293, with C-His labeled tag.
Background
The C-type agglutinin-like receptors (CLECs) family consists of different transmembrane pattern recognition receptors. CLECs play a key role in regulating cancer cell growth, maintaining hemostasis and promoting cell communication. CLEC14A is a type I transmembrane protein belonging to the C-type lectin superfamily that mediates intercellular adhesion, inflammatory response, and apoptosis. CLEC14A contributes to the germination and stability of blood vessels during angiogenesis and the formation of normal lymphatic sacs and blood vessels by regulating the expression levels and signaling of VEGFR-3 and VEGFR-2. CLEC14A is upregulated in hepatocellular carcinoma and may serve as a potential diagnostic biomarker[1][2][3].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CLEC14A Protein is immobilized at 1 µg/mL (100 µL/well) can bind Mouse VEGF R3 Protein. The ED50 for this effect is 1.61 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8VCP9 (E22-T386)
-
Molecular Construction
-
N-term
-
CLEC14A (E22-T386)
Accession # Q8VCP9 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC14A; ClECT And EGF-Like Domain Containing Protein; Prev. C14orf27; Chromosome 14 Open Reading Frame 27; C-Type Lectin Domain Family 14 Member A; EGFR5; Epidermal Growth Factor Receptor 5; CEG1; EGFR-5; C-Type Lectin Domain Containing 14A; C-Type Lecti
-
AA Sequence
EHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSST
-
Molecular Weight
Approximately 75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
