I-TAC/CXCL11 Protein, Mouse
Based on 1 Customer Validation
The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Almacenamiento:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Actividad biológica
-
Technical Parameters
-
Product Properties
- Documentación
- Help & FAQs
Actividad biológica
The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.
CXCL11 protein exhibits specific chemotactic activity for interleukin-activated T-cells but not for unstimulated T-cells, neutrophils, or monocytes. Its capacity to induce calcium release specifically in activated T-cells suggests a targeted role in the immune response. By binding to CXCR3, CXCL11 is intricately involved in T-cell chemotaxis, indicating its potential significance in diseases of the central nervous system that involve T-cell recruitment. Furthermore, CXCL11 may contribute to skin immune responses, as inferred by similarities in its function. The interaction of CXCL11 with TNFAIP6 via the Link domain suggests a regulatory role, emphasizing its involvement in modulating chemokine activity within complex cellular microenvironments.
Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR3. The ED50 for this effect is 5.904 ng/mL, corresponding to a specific activity is 1.694×105 U/mg.
-
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR3. The ED50 for this effect is 5.904 ng/mL, corresponding to a specific activity is 1.694×105 U/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9JHH5 (F22-M100)
-
Molecular Construction
-
N-term
-
CXCL11 (F22-M100)
Accession # Q9JHH5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Cxcl11; Scyb11C-X-C motif chemokine 11; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11
-
AA Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
-
Predicted Molecular Mass
9.1 kDa
-
Peso molecular
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Pureza
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentación
-
Ficha de datos (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
