CXCL14/BRAK Protein, Human (Biotinylated)
Based on 1 Customer Validation
CXCL14 (also known as breast and kidney-expressed chemokine (BRAK)), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity. CXCL14/BRAK Protein, Human (Biotinylated), a Biotinylated CXCL14 protein, is produced in E. coli, and consists of 77 amino acids (S35-E111).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
CXCL14 (also known as breast and kidney-expressed chemokine (BRAK)), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity[1][2]. CXCL14/BRAK Protein, Human (Biotinylated), a Biotinylated CXCL14 protein, is produced in E. coli, and consists of 77 amino acids (S35-E111).
The chemokine CXCL14 is a highly conserved, homeostatic chemokine which is constitutively expressed in several normal tissues including adipose, brain, breast, cervix, lung, kidney, and skin. CXCL14 is involved in infectious and inflammatory diseases, angiogenesis, and cancer[1][2].
Among chemokines, CXCL14 is highly conserved in mammals with only two amino acids difference between mice and humans. CXCL14 has four conserved cysteine residues that form disulfide bonds7. Also, in common, the first 22 amino acids of the N-terminus are strongly hydrophobic and act as a signal peptide, which is cleaved prior to secretion. Like other chemokines, CXCL14 is a chemoattractant, especially for monocytes, and induces maturation and migration of dendritic cells (DCs). However, the CXCL14-related migration of monocyte in the absence of prostaglandin E2 (PGE2) is weak, showing that PGE2 is required for CXCL14-related chemotaxis. Responsiveness of monocytes to CXCL14 and PGE2 is specific, and B and T cells do not have any chemotactic response. In addition to monocytes, CXCL14 specifically increases chemotaxis of CD56+ natural killer (NK) cells. Responsible for immune cell recruitment and maturation, as well as impacting epithelial cell motility, CXCL14 contributes to the establishment of immune surveillance within normal epithelial layers. Overall, CXCL14 is responsible for the infiltration of immune cells, maturation of dendritic cells, upregulation of major histocompatibility complex (MHC)-I expression, and cell mobilization. Although fibroblast-derived CXCL14 has a tumor-supportive role, epithelial-derived CXCL14 mainly inhibits tumor progression[1][2].
Many previous studies on CXCL14 have shown contradictory functions of CXCL14: tumor suppression vs. promotion, increased vs. decreased cell migration, angiogenesis vs. angiostasis, and CXCR4 inhibition vs. activation vs. no effect. CXCL14 inhibits chemotaxis of endothelial cells by directly binding to IL-8 and FGF2, thus hindering their interaction with high-affinity receptors on human vascular endothelial cells. Moreover, CXCL14 broadly modulates chemotaxis, differentiation, and activation of various types of immune cells. Furthermore, CXCL14 also shows antimicrobial activity that effectively clears infection of Streptococcus pneumoniae in respiratory tracts[2].
Recombinant human CXCL14 (5-2 ng/mL) induced dendritic cell attraction in head and neck squamous cell carcinoma (HNSCC). CXCL14 resultes in up-regulation of the expression of dendritic cell maturation markers, as well as enhanced proliferation of allogeneic T cells in MLR. Activation of dendritic cell with recombinant human CXCL14 is accompanied by up-regulation of NF-κB activity[3].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O95715 (S35-E111)
-
Molecular Construction
-
N-term
-
CXCL14 (S35-E111)
Accession # O95715 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
CXCL14; Kec; Prev. SCYB14; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 14 (BRAK); NJAC; Chemokine (C-X-C Motif) Ligand 14; Small-Inducible Cytokine B14; Breast And Kidney; C-X-C Motif Chemokine 14; MIP-2G; Chemokine BRAK; MIP2G; Bolekine; CXC
-
AA Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
-
Predicted Molecular Mass
9.4 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Arezoo Gowhari Shabgah, et al. Chemokine CXCL14; a double-edged sword in cancer development. Int Immunopharmacol. 2021 Aug;97:107681. [Content Brief]
[2]. Joseph A Westrich, et al. The multifarious roles of the chemokine CXCL14 in cancer progression and immune responses. Mol Carcinog. 2020 Jul;59(7):794-806. [Content Brief]
[3]. Galina V Shurin, et al. Loss of new chemokine CXCL14 in tumor tissue is associated with low infiltration by dendritic cells (DC), while restoration of human CXCL14 expression in tumor cells causes attraction of DC both in vitro and in vivo. J Immunol. 2005 May 1;174(9):5490-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)