Copy Link Print Information

Dectin-2/CLEC6A Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Dectin-2/CLEC6A Protein, Mouse (HEK293, His)
  • Dectin-2/CLEC6A Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Dectin-2/CLEC6A Protein exhibits carbohydrate binding activity and pattern recognition receptor activity, playing a role in various processes such as positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and response to fungus. It is predicted to be located in the membrane and serves as an integral component of the membrane, specifically the external side of the plasma membrane. Dectin-2/CLEC6A Protein is expressed in tissues including bone marrow, embryo, lung, spleen, and thymus. It is the orthologous counterpart to human CLEC6A gene. Notably, Dectin-2/CLEC6A Protein displays biased expression in liver E18 (RPKM 6.6), spleen adult (RPKM 5.8), and 13 other tissues.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9JKF4-1/NP_064385.1 (I44-L209)

  • Gene ID
    56620  [NCBI]
  • Molecular Construction
    • N-term
    • CLEC7A (I44-L209)
      Accession # Q9JKF4-1/NP_064385.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC6A; Dendritic Cell-Associated C-Type Lectin 2; Prev. CLECSF10; DC-Associated C-Type Lectin 2; Dectin-2; C-Type Lectin Domain Family 6, Member A; C-Type Lectin Domain Family 6 Member A; Dectin 2; HDECTIN-2; DECTIN2; C-Type (Calcium Dependent, Carbohydr

  • AA Sequence

    IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Dectin-2/CLEC6A Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Dectin-2/CLEC6A Protein, Mouse (HEK293, His)
  • Dectin-2/CLEC6A Protein, Mouse (HEK293, His) Product Image