Copy Link Print Information

LAMP3/CD208 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

LAMP3/CD208 is a lysosomal glycoprotein that participates in the unfolded protein response (UPR) and contributes to protein degradation and cell survival, especially in the presence of proteasome dysfunction.It crucially promotes lysosome-autophagosome fusion and regulates autophagy.LAMP3/CD208 Protein, Human (HEK293, His) is the recombinant human-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LAMP3/CD208 Protein, Human (HEK293, His)
  • Experimental Validation Results for LAMP3/CD208 Protein, Human (HEK293, His)
  • LAMP3/CD208 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

LAMP3/CD208 is a lysosomal glycoprotein that participates in the unfolded protein response (UPR) and contributes to protein degradation and cell survival, especially in the presence of proteasome dysfunction.It crucially promotes lysosome-autophagosome fusion and regulates autophagy.LAMP3/CD208 Protein, Human (HEK293, His) is the recombinant human-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

Background

LAMP3/CD208, a lysosomal membrane glycoprotein, is involved in the unfolded protein response (UPR), contributing to protein degradation and cell survival particularly during proteasomal dysfunction. Additionally, it plays a crucial role in the fusion process between lysosomes and autophagosomes, thereby modulating autophagy. LAMP3/CD208 has been identified as a promoter of hepatocellular lipogenesis through the activation of the PI3K/Akt pathway. Furthermore, it is implicated in dendritic cell function and adaptive immunity. In the context of microbial infection, LAMP3/CD208 plays a positive role in post-entry steps of influenza A virus replication, influencing processes such as virus uncoating, cytosolic transport, or nuclear import of viral components, and contributing to the nuclear accumulation of influenza nucleoprotein/NP during the early stages of viral infection.

Verified Bioactivity

Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.401μg/mL, corresponding to a specific activity is 2.494×103 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.401 μg/mL, corresponding to a specific activity is 2.494×103 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9UQV4/NP_055213.2 (K28-T381)

  • Gene ID
    27074  [NCBI]
  • Molecular Construction
    • N-term
    • LAMP3 (K28-T381)
      Accession # Q9UQV4/NP_055213.2
    • His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    LAMP3; CD208; Lysosome Associated Membrane Protein 3; LAMP; Lysosomal Associated Membrane Protein 3; Lysosomal-Associated Membrane Protein 3; TSC403; DC LAMP; DCLAMP; LAMP-3; DC-Lysosome-Associated Membrane Glycoprotein; Protein TSC403; Lysosome-Associate

  • AA Sequence

    KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

  • Molecular Weight

    Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.401 μg/mL, corresponding to a specific activity is 2.494×103 U/mg.

  • LAMP3/CD208 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for LAMP3/CD208 Protein, Human (HEK293, His)
  • Experimental Validation Results for LAMP3/CD208 Protein, Human (HEK293, His)
  • LAMP3/CD208 Protein, Human (HEK293, His) Product Image