LAMP3/CD208 Protein, Human (HEK293, His)

LAMP3/CD208 is a lysosomal glycoprotein that participates in the unfolded protein response (UPR) and contributes to protein degradation and cell survival, especially in the presence of proteasome dysfunction.It crucially promotes lysosome-autophagosome fusion and regulates autophagy.LAMP3/CD208 Protein, Human (HEK293, His) is the recombinant human-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

LAMP3/CD208, a lysosomal membrane glycoprotein, is involved in the unfolded protein response (UPR), contributing to protein degradation and cell survival particularly during proteasomal dysfunction. Additionally, it plays a crucial role in the fusion process between lysosomes and autophagosomes, thereby modulating autophagy. LAMP3/CD208 has been identified as a promoter of hepatocellular lipogenesis through the activation of the PI3K/Akt pathway. Furthermore, it is implicated in dendritic cell function and adaptive immunity. In the context of microbial infection, LAMP3/CD208 plays a positive role in post-entry steps of influenza A virus replication, influencing processes such as virus uncoating, cytosolic transport, or nuclear import of viral components, and contributing to the nuclear accumulation of influenza nucleoprotein/NP during the early stages of viral infection.

Measured by its ability to enhance MDA-MB-231 cells migration. The ED₅₀ for this effect is 0.401μg/mL, corresponding to a specific activity is 2.494×10³ U/mg.

• 
  Measured by its ability to enhance MDA-MB-231 cells migration. The ED₅₀ for this effect is 0.401 μg/mL, corresponding to a specific activity is 2.494×10³ U/mg.

Human

HEK293

C-6*His

Q9UQV4/NP_055213.2 (K28-T381)

27074  [NCBI]

Lumenal Domain

KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

Approximately 70-100 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/baf3-cell.html  [Content Brief]