1. Recombinant Proteins
  2. Viral Proteins
  3. Hepatitis C Virus Proteins
  4. Hepatitis C virus E2 Proteins
  5. E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His)

E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His)

Cat. No.: HY-P74183
Handling Instructions Technical Support

E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His) is the recombinant Virus-derived E2/Envelope protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His) is the recombinant Virus-derived E2/Envelope protein, expressed by HEK293, with C-His labeled tag.

Background

The POLG protein plays a multifaceted role in the life cycle of the virus, contributing to various stages of viral replication and modulating host cellular processes. It is instrumental in packaging viral RNA to form the viral nucleocapsid, promoting virion budding, and participating in viral particle production through interaction with non-structural protein 5A. Additionally, POLG exhibits RNA-binding activity, suggesting a potential role as an RNA chaperone that induces structural rearrangements during virus replication. This versatile protein influences viral translation initiation by interacting with viral internal ribosomal entry site (IRES) and 40S ribosomal subunits. Beyond its direct involvement in viral processes, POLG impacts cell signaling pathways, host immunity, and lipid metabolism. It impedes the establishment of a cellular antiviral state by blocking interferon-alpha/beta and interferon-gamma signaling, inhibiting STAT1 phosphorylation, and promoting STAT1 degradation. Moreover, POLG activates STAT3, contributing to cellular transformation. The protein also regulates cellular gene activity, suppressing p53 promoter activity, sequestering CREB3 and SP110 isoform 3 in the cytoplasm, and repressing CDKN1A, thereby disrupting cell cycle regulation. POLG further influences transcription factors involved in inflammatory responses and the immune response, affecting NF-kappa-B activation and AP-1. Its interaction with dendritic cells down-regulates T-lymphocyte proliferation. In the context of lipid metabolism, POLG interacts with hepatocellular proteins to induce lipid accumulation and storage. Additionally, POLG forms a heterodimer with envelope glycoprotein E2, facilitating virus attachment, internalization, and fusion with the host membrane. The E1/E2 heterodimer's interaction with host apolipoproteins forms a lipo-viro-particle, allowing virus attachment to cell surface receptors and triggering HCV entry via activation of the EGFR signaling pathway.

Species

Virus

Source

HEK293

Tag

C-His

Accession

AAC15723 (E384-E661)

Gene ID

/

Molecular Construction
N-term
HCV E2 (E384-E661)
Accession # AAC15723
His
C-term
Protein Length

Partial

Synonyms
HCV-1a E2 Protein; Hepatitis C virus (serotype 1b, isolate HC-J4) Envelope/E2 Protein
AA Sequence

ETHTTGRVAGHTTSGFTSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALFYAHKFNSSGCPERMASCRPIDWFAQGWGPITYTKPNSSDQRPYCWHYAPRPCGVVPASQVCGPVYCFTPSPVVVGTTDRSGVPTYSWGENETDMMLLNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNRTLICPTDCFRKHPEATYTKCGSGPWLTPRCLVDYPYRLWHYPCTLNFSIFKVRMYVGGVEHRLNAACNWTRGERCNLEDRDRSE

Predicted Molecular Mass
32.4 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E2/Envelope Protein, Hepatitis C virus (AAC15723, HEK293, His)
Cat. No.:
HY-P74183
Quantity:
MCE Japan Authorized Agent: