FABP5 Protein, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP5 Protein, Human (His) is 134 a.a., with molecular weight of ~17 kDa.

FABP5 functions as an intracellular carrier for long-chain fatty acids and related active lipids, including endocannabinoids, thereby regulating the metabolism and actions of the ligands they bind. In addition to its role in cytosolic transport, FABP5 selectively delivers specific fatty acids from the cytosol to the nucleus, where they activate nuclear receptors. Notably, it delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 may also serve as a synaptic carrier of endocannabinoids at central synapses, thereby controlling retrograde endocannabinoid signaling. Furthermore, it modulates inflammation by regulating PTGES induction via NF-kappa-B activation and prostaglandin E2 (PGE2) biosynthesis during inflammatory processes. Additionally, FABP5's potential involvement in keratinocyte differentiation has been suggested.

Human

E. coli

N-6*His

Q01469 (A2-E135)

2171  [NCBI]

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.