FGF-19 Protein, Human (His)
Based on 1 Customer Validation
FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (His) is the recombinant human-derived FGF-19 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (His) is the recombinant human-derived FGF-19 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The FGF-19 Protein plays a pivotal role in the regulation of bile acid biosynthesis by suppressing CYP7A1 expression through the positive modulation of the JNK and ERK1/2 cascades. Additionally, FGF-19 stimulates glucose uptake in adipocytes, and its activity is contingent upon the presence of both KLB and FGFR4. The protein forms crucial interactions with FGFR1, FGFR2, FGFR3, and FGFR4, emphasizing its involvement in FGF receptor signaling pathways. The affinity between FGFs and their receptors is augmented by KL, KLB, and heparan sulfate glycosaminoglycans, acting as coreceptors. FGF-19 directly interacts with KL and KLB, and in the presence of heparin, KL, or KLB, it forms an interaction with FGFR4. Additionally, FGF-19 interacts with MALRD1, highlighting its diverse molecular associations and suggesting its involvement in intricate cellular processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human FGFR4 (HY-P73057) is present at 5 μg/mL can bind Recombinant biotinylated Human FGF-19. The ED50 for this effect is 37.41 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O95750 (F27-K216)
-
Molecular Construction
-
N-term
-
6*His
-
FGF-19 (F27-K216)
Accession # O95750 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF19; Fibroblast Growth Factor; Fibroblast Growth Factor 19; FGF; FGF-19
-
AA Sequence
FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
-
Predicted Molecular Mass
23.5 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)