FOXC1 Protein, Human (C-His)

Customer Review

Based on 1 Customer Validation

FOXC1 Protein, Human (C-His) is the recombinant human-derived FOXC1 protein, expressed by E. coli, with C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FOXC1 Protein, Human (C-His) is the recombinant human-derived FOXC1 protein, expressed by E. coli, with C-6*His tag.

Background

FOXC1 is a DNA-binding transcriptional factor involved in a broad range of cellular and developmental processes, including eye, bone, cardiovascular, kidney, and skin development. It functions as either a transcriptional activator or repressor, binding to the consensus sequence 5'-[G/C][A/T]AAA[T/C]AA[A/C]-3' in target gene promoters and promoting DNA bending upon binding. FOXC1 also acts as a transcriptional coactivator, enhancing GLI2-mediated DNA binding to stimulate Indian hedgehog (Ihh)-induced target gene expression (By similarity), thereby regulating endochondral ossification. In breast cancer cells, it serves as a transcriptional coregulator by increasing GLI2's DNA-binding capacity. FOXC1 regulates FOXO1 by binding to the conserved element 5'-GTAAACAAA-3' in its promoter, influencing cell viability and oxidative stress resistance. Additionally, it cooperates with FOXC2 to regulate genes maintaining podocyte integrity (By similarity) and inhibits cell growth via TGFB1-mediated G1 phase arrest. FOXC1 is implicated in epithelial-mesenchymal transition (EMT), promoting proliferation, migration, and invasion, and controls CXCR4 expression in CXCL12-induced endothelial cell migration (By similarity). It is essential for epidermal keratinocyte terminal differentiation and positively regulates CXCL12 and stem cell factor expression in bone marrow mesenchymal progenitor cells, contributing to hematopoietic stem and progenitor cell (HSPC) niche maintenance. During embryonic development, FOXC1 prevents blood and lymphatic vessel growth in a VEGF-dependent manner to ensure corneal transparency. Some evidence suggests it may function as a tumor suppressor.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FOXC1 (M1-F553)
      Accession # Q12948
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FOXC1; Forkhead-Related Protein FKHL7; Prev. FKHL7; Forkhead/Winged Helix-Like Transcription Factor 7; Prev. IRID1; Forkhead, Drosophila, Homolog-Like 7; FREAC3; Forkhead-Related Activator 3; Forkhead Box Protein C1; Forkhead Box C1 Protein; IGDA; Myeloid

  • AA Sequence

    MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF

  • Predicted Molecular Mass

    63.7 kDa

  • Molecular Weight

    Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00