Copy Link Print Information

Frizzled-7 Protein, Human (CHO, hFc)

Customer Review

Based on 1 Customer Validation

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Frizzled-7 Protein, Human (CHO, hFc)
  • Experimental Validation Results for Frizzled-7 Protein, Human (CHO, hFc)
  • Frizzled-7 Protein, Human (CHO, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Background

The Frizzled-7 (FZD7) Protein, a member of the 'frizzled' gene family, encodes a 7-transmembrane domain receptor for Wnt signaling proteins. The FZD7 protein structure includes an N-terminal signal sequence, a cysteine-rich extracellular domain with 10 cysteine residues characteristic of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail featuring a PDZ domain-binding motif. The expression of the FZD7 gene is implicated in potentially downregulating APC function and enhancing beta-catenin-mediated signals, particularly observed in poorly differentiated human esophageal carcinomas. This highlights FZD7's role in modulating critical cellular signaling pathways, particularly in the context of cancer progression.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-7, at 0.1μg/mL (100 μL/well) can bind Biotinylated Wnt-5a. The ED50 for this effect is 257.8 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-7, at 0.1 μg/mL (100 μL/well) can bind Biotinylated Wnt-5a.The ED50 for this effect is 257.8 ng/mL.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag C-hFc
  • Accession

    O75084/NP_003498 (Q33-L185)

  • Gene ID
    8324  [NCBI]
  • Molecular Construction
    • N-term
    • Frizzled-7 (Q33-L185)
      Accession # NP_003498
    • hFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD7; Fz-7; Frizzled Class Receptor 7; HFz7; FzE3; Frizzled, Drosophila, Homolog Of, 7; Frizzled-7; Frizzled (Drosophila) Homolog 7; Frizzled 7, Seven Transmembrane Spanning Receptor; Frizzled Homolog 7 (Drosophila); Frizzled Family Receptor 7; Frizzled H

  • AA Sequence

    QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

  • Molecular Weight

    Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-7, at 0.1 μg/mL (100 μL/well) can bind Biotinylated Wnt-5a.The ED50 for this effect is 257.8 ng/mL.

  • Frizzled-7 Protein, Human (CHO, hFc) Product Image
    1/16
  • Experimental Validation Results for Frizzled-7 Protein, Human (CHO, hFc)
  • Experimental Validation Results for Frizzled-7 Protein, Human (CHO, hFc)
  • Frizzled-7 Protein, Human (CHO, hFc) Product Image