1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TGF-beta Superfamily Neurotrophic Factors Cytokine Receptors
  4. GDNF family
  5. GFRAL
  6. GFRAL Protein, Mouse (HEK293, His-Avi)

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.

Biological Activity

1. Immobilized Mouse GFRAL, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Mouse GDF15, hFc Tag with the EC50 of less than 6.5ng/ml determined by ELISA.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse GFRAL at 0.1 μg/mL (100μL/well) can bind Biotinylated Mouse GDF-15 (HY-P77945A). The ED50 for this effect is 1.458 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse GFRAL at 0.1 μg/mL (100 μL/well) can bind Biotinylated Mouse GDF-15 (HY-P77945A). The ED50 for this effect is 1.458 ng/mL.
Species

Mouse

Source

HEK293

Tag

N-His;N-Avi

Accession

Q6SJE0-1 (Q20-E350)

Gene ID
Molecular Construction
N-term
His-Avi
GFRAL (Q20-E350)
Accession # Q6SJE0-1
C-term
Protein Length

Partial

Synonyms
GFR alpha-like; GFRAL; GRAL; C6orf144
AA Sequence

QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNGE

Molecular Weight

Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GFRAL Protein, Mouse (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFRAL Protein, Mouse (HEK293, His-Avi)
Cat. No.:
HY-P77947
Quantity:
MCE Japan Authorized Agent: