GFRAL Protein, Mouse (HEK293, His-Avi)

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Avi) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.

1. Immobilized Mouse GFRAL, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Mouse GDF15, hFc Tag with the EC₅₀ of less than 6.5ng/ml determined by ELISA.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse GFRAL at 0.1 μg/mL (100μL/well) can bind Biotinylated Mouse GDF-15 (HY-P77945A). The ED₅₀ for this effect is 1.458 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse GFRAL at 0.1 μg/mL (100 μL/well) can bind Biotinylated Mouse GDF-15 (HY-P77945A). The ED₅₀ for this effect is 1.458 ng/mL.

Mouse

HEK293

N-His;N-Avi

Q6SJE0-1 (Q20-E350)

404194  [NCBI]

Partial

QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNGE

45-60 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.