Copy Link Print Information

GMP IL-15 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. GMP IL-15 Protein, Human is the recombinant human-derived IL-15 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GMP IL-15 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The IL-15 protein is a cytokine that plays a key role in inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. GMP IL-15 Protein, Human is the recombinant human-derived IL-15 protein, expressed by E. coli , with tag free.

Background

IL-15 Protein assumes a pivotal role in orchestrating inflammatory and protective immune responses against microbial invaders and parasites, modulating immune cells across both the innate and adaptive immune systems. This cytokine stimulates the proliferation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. Notably, IL-15, unlike most cytokines, is expressed on the surface of IL-15-producing cells in association with its high-affinity receptor IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding to its receptor, IL-15 triggers the phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, attracting neutrophils and monocytes to infection sites. Additionally, in mast cells, IL-15 induces rapid tyrosine phosphorylation of STAT6, exerting control over mast cell survival and the release of cytokines such as IL4.

In Vitro

GMP IL-15 Protein, Human (0-100 ng/mL, 24 h) induces the IL-5 production in human derfII-specific T cell clone and the proliferation of T cell clones[1].

In Vivo

GMP IL-15 Protein, Human (200 μg/day, ip, once daily for 4 days) promotes the proliferation and survival of NK cells in peripheral blood, spleen and bone marrow of mice[2].

Verified Bioactivity

Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The specific activity of Recombinant human IL-15 is ≥ 1.0 × 107 IU/mg. which is calibrated against human IL-15 WHO International Standard.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P40933-1 (N49-S162)

  • Gene ID
    3600  [NCBI]
  • Molecular Construction
    • N-term
    • IL-15 (N49-S162)
      Accession # P40933-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15

  • AA Sequence

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 4% Mannitol, pH 7.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Mori A, et al. IL-15 promotes cytokine production of human T helper cells[J]. Journal of immunology (Baltimore, Md.: 1950), 1996, 156(7): 2400-2405.

[2]. Sun W, et al., High level expression and purification of active recombinant human interleukin-15 in Pichia pastoris. J Immunol Methods. 2016 Jan;428:50-7. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GMP IL-15 Protein, Human Product Image
    1/16
  • GMP IL-15 Protein, Human Product Image