1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Granzyme K Protein, Human (His)

Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag[1][2].

Background

Granzyme K is a serine protease, belonging to the granzyme family of proteins. Granzyme K is similar to Granzyme A in that they are the only granzymes that display tryptase-like activity. Granzyme K induces cell death by single-stranded nicking of the chromosomal DNA by cleaving the same components of the endoplasmic reticulum-associated SET complex. Granzyme K may provide a backup and failsafe mechanism for Granzyme A with redundant specificity. Natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) store Granzyme K in their granules which they release to induce apoptosis in target cells. Granzyme K is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. In autoimmune disorders granzyme K works in combination with proteins like perforin which facilitates entry of granzymes into the cell to stimulate apoptosis[1][2].

In Vitro

Granzyme K Protein, Human (His) cleaves synthetic thiobenzyl ester substrates after Lys and Arg with kcat/Km values of 3.7 × 104 and 4.4 × 104/m·s, respectively[1].
Granzyme K Protein, Human (His)'s (3 nM; 60 min) activity can be inhibited by the synthetic compounds Phe-Pro-Arg-chloromethyl ketone, PMSF (HY-B0496), PefablocSC, Benzamidine (HY-125913), and the Kunitz-type inhibitor Aprotinin (HY-P0017)[1].
Granzyme K Protein, Human (His)'s (3 nM; 15 min) activity can be inhibited by the plasma-derived inter-α-trypsin inhibitor complex, its bikunin subunit, and the second carboxyl-terminal Kunitz-type domain of bikunin with Ki values of 64, 50, and 22 nm, respectively[1].
Granzyme K Protein, Human (His) (1 μM; 5-60 min) is markedly more efficient in cleaving heterogeneous ribonuclear protein K than Granzyme A[2].
Granzyme K Protein, Human (His) (5-100 nM; 2 h) cleaves the microtubule network protein β-tubulin after two distinct Arg residues[2].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P49863 (I27-N264)

Gene ID

3003

Protein Length

Full Length of Mature Protein

Synonyms
Fragmentin-3; Granzyme-3; NK-tryptase-2 (NK-Tryp-2); GZMK
AA Sequence

IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

Molecular Weight

32 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Granzyme K Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Granzyme K Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Granzyme K Protein, Human (His)
Cat. No.:
HY-P702811
Quantity:
MCE Japan Authorized Agent: