Granzyme K Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag[1][2].

Background

Granzyme K is a serine protease, belonging to the granzyme family of proteins. Granzyme K is similar to Granzyme A in that they are the only granzymes that display tryptase-like activity. Granzyme K induces cell death by single-stranded nicking of the chromosomal DNA by cleaving the same components of the endoplasmic reticulum-associated SET complex. Granzyme K may provide a backup and failsafe mechanism for Granzyme A with redundant specificity. Natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) store Granzyme K in their granules which they release to induce apoptosis in target cells. Granzyme K is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. In autoimmune disorders granzyme K works in combination with proteins like perforin which facilitates entry of granzymes into the cell to stimulate apoptosis[1][2].

In Vitro

Granzyme K Protein, Human (His) cleaves synthetic thiobenzyl ester substrates after Lys and Arg with kcat/Km values of 3.7 × 104 and 4.4 × 104/m·s, respectively[1].
Granzyme K Protein, Human (His)'s (3 nM; 60 min) activity can be inhibited by the synthetic compounds Phe-Pro-Arg-chloromethyl ketone, PMSF (HY-B0496), PefablocSC, Benzamidine (HY-125913), and the Kunitz-type inhibitor Aprotinin (HY-P0017)[1].
Granzyme K Protein, Human (His)'s (3 nM; 15 min) activity can be inhibited by the plasma-derived inter-α-trypsin inhibitor complex, its bikunin subunit, and the second carboxyl-terminal Kunitz-type domain of bikunin with Ki values of 64, 50, and 22 nm, respectively[1].
Granzyme K Protein, Human (His) (1 μM; 5-60 min) is markedly more efficient in cleaving heterogeneous ribonuclear protein K than Granzyme A[2].
Granzyme K Protein, Human (His) (5-100 nM; 2 h) cleaves the microtubule network protein β-tubulin after two distinct Arg residues[2].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GZMK; Tryptase II; Granzyme K; Granzyme-3; TRYP2; NK-Tryp-2; Fragmentin-3; PRSS; Granzyme K (Serine Protease, Granzyme 3; Tryptase II); GrK; Granzyme K (Granzyme 3; Tryptase II); Granzyme 3; NK-Tryptase-2

  • AA Sequence

    IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

  • Predicted Molecular Mass

    29.9 kDa

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00