Granzyme K Protein, Human (His)
Based on 1 Customer Validation
Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Granzyme K is a serine protease. Granzyme K can degrade cellular proteins once introduced into a target cell's cytoplasm leading to apoptosis. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. Granzyme K Protein, Human (His) is the recombinant human-derived Granzyme K, expressed by E. coli , with N-6*His labeled tag[1][2].
Background
Granzyme K is a serine protease, belonging to the granzyme family of proteins. Granzyme K is similar to Granzyme A in that they are the only granzymes that display tryptase-like activity. Granzyme K induces cell death by single-stranded nicking of the chromosomal DNA by cleaving the same components of the endoplasmic reticulum-associated SET complex. Granzyme K may provide a backup and failsafe mechanism for Granzyme A with redundant specificity. Natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) store Granzyme K in their granules which they release to induce apoptosis in target cells. Granzyme K is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes. Granzyme K shows significant connections to inflammatory conditions and autoimmune diseases such as rheumatoid arthritis. In autoimmune disorders granzyme K works in combination with proteins like perforin which facilitates entry of granzymes into the cell to stimulate apoptosis[1][2].
In Vitro
Granzyme K Protein, Human (His) cleaves synthetic thiobenzyl ester substrates after Lys and Arg with kcat/Km values of 3.7 × 104 and 4.4 × 104/m·s, respectively[1].
Granzyme K Protein, Human (His)'s (3 nM; 60 min) activity can be inhibited by the synthetic compounds Phe-Pro-Arg-chloromethyl ketone, PMSF (HY-B0496), PefablocSC, Benzamidine (HY-125913), and the Kunitz-type inhibitor Aprotinin (HY-P0017)[1].
Granzyme K Protein, Human (His)'s (3 nM; 15 min) activity can be inhibited by the plasma-derived inter-α-trypsin inhibitor complex, its bikunin subunit, and the second carboxyl-terminal Kunitz-type domain of bikunin with Ki values of 64, 50, and 22 nm, respectively[1].
Granzyme K Protein, Human (His) (1 μM; 5-60 min) is markedly more efficient in cleaving heterogeneous ribonuclear protein K than Granzyme A[2].
Granzyme K Protein, Human (His) (5-100 nM; 2 h) cleaves the microtubule network protein β-tubulin after two distinct Arg residues[2].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P49863 (I27-N264)
-
Gene ID3003
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GZMK; Tryptase II; Granzyme K; Granzyme-3; TRYP2; NK-Tryp-2; Fragmentin-3; PRSS; Granzyme K (Serine Protease, Granzyme 3; Tryptase II); GrK; Granzyme K (Granzyme 3; Tryptase II); Granzyme 3; NK-Tryptase-2
-
AA Sequence
IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
-
Predicted Molecular Mass
29.9 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wilharm E, et al. Generation of catalytically active granzyme K from Escherichia coli inclusion bodies and identification of efficient granzyme K inhibitors in human plasma. J Biol Chem. 1999 Sep 17;274(38):27331-7. [Content Brief]
[2]. Bovenschen N, et al. Granzyme K displays highly restricted substrate specificity that only partially overlaps with granzyme A. J Biol Chem. 2009 Feb 6;284(6):3504-12. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)