IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His) contains 162 a.a. (C25-E186), produced in HEK293 cells with a C-terminal His-tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His) contains 162 a.a. (C25-E186), produced in HEK293 cells with a C-terminal His-tag.
Background
IFN-alpha 4 (IFNA4; IFN-α4), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[1].
Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[2].
IFN-alpha 4 is the subtypes dominates in IFN-alpha, whose the response with IFNA5, IFNA7, and IFNA14 accounting for up to 85% of the subtypes expressed by Peripheral blood mononuclear cells (PBMCs)[3].
IFN-alpha 4 is promoted by interferon (IFN) regulatory factors (IRFs), especially IRF-1 and IRF-7[5][6]. And it exhibits function by inhibiting virus RNA replication and enhances human natural killer cytotoxicity against virus[4][7].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA4 protein of mouse shows 80.98% similarity with, but is very different from mouse (59.57%).
In Vitro
The murine IFN-alpha 4 (IFNA4) promoter can be induced by IRF-1 or viral infection, is not induced by IRF-3, which belongs to the family of interferon (IFN) regulatory factors (IRFs)[5].
Verified Bioactivity
Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 10-50 pg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P07351 (C25-E186)
-
Molecular Construction
-
N-term
-
IFNA4 (C25-E186)
Accession # P07351 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA4; Interferon Alpha-M1; Interferon Alpha 4; Interferon Alpha-4; IFN-Alpha4a; IFN-Alpha-4; Interferon Alpha-4B; MGC142200; Interferon Alpha-76; INFA4
-
AA Sequence
CDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE
-
Predicted Molecular Mass
20.2 kDa
-
Molecular Weight
Approximately 22-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (265 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]
[2]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5. [Content Brief]
[3]. Li Y, et al. Expression Pattern of Individual IFNA Subtypes in Chronic HIV Infection. J Interferon Cytokine Res. 2017 Dec;37(12):541-549. [Content Brief]
[4]. Verhagen A, et al. Comparison of augmentation of human natural killer cell cytotoxicity by interferon-alpha subtypes. Nat Immun Cell Growth Regul. 1990;9(5):325-33. [Content Brief]
[5]. Au WC, et al. Identification of a member of the interferon regulatory factor family that binds to the interferon-stimulated response element and activates expression of interferon-induced genes. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11657-61. [Content Brief]
[6]. Lin R, et al. Selective DNA binding and association with the CREB binding protein coactivator contribute to differential activation of alpha/beta interferon genes by interferon regulatory factors 3 and 7. Mol Cell Biol. 2000 Sep;20(17):6342-53. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
