IL-1 beta Protein, Mouse (His, Avi)
Based on 1 Customer Validation
IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. IL-1 beta Protein, Mouse (His, Avi) is the recombinant mouse-derived IL-1 beta protein, expressed by E. coli, with N-Avi and N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. IL-1 beta Protein, Mouse (His, Avi) is the recombinant mouse-derived IL-1 beta protein, expressed by E. coli, with N-Avi and N-His labeled tag.
IL-1 beta Protein is a potent pro-inflammatory cytokine that was initially discovered as the major endogenous pyrogen. It has various effects on immune cells, such as inducing prostaglandin synthesis, activating neutrophils, promoting T-cell activation and cytokine production, stimulating B-cell activation and antibody production, and increasing fibroblast proliferation and collagen production. IL-1 beta Protein also plays a role in promoting the differentiation of Th17 cells and works synergistically with IL12 to induce the synthesis of IFNG by Th1 cells. Moreover, it contributes to angiogenesis by inducing VEGF production in collaboration with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular environment through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV, as well as integrins ITGAV:ITGBV and ITGA5:ITGB1, which are required for IL1B signaling. IL-1 beta Protein also interacts with the cargo receptor TMED10 and HSP90AB1 and HSP90B1, which facilitate the translocation of cargo into the ERGIC.
1.Immobilized Mouse IL-1 Beta, His Tag at 5 μg/mL (100μL/well) on the plate. Dose response curve for Human IL-1R2, hFc Tag with the EC50 of < 0.2 μg/ml determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-1 Beta at 5 μg/mL (100 μl/well) can bind Human IL-1R2. The ED50 for this effect is < 0.2 μg/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
P10749 (V118-S269)
-
Gene ID16176
-
Molecular Construction
-
N-term
-
8*His-Avi
-
IL-1 beta (V118-S269)
Accession # P10749 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)